updated: Tuesday, 11 June 2019, 19:36:31


Document is not valid

144 errors and 127 warnings in 77 lines
size: 633509 bytes, 5571 lines
doctype: -//W3C//DTD XHTML 1.0 Strict//EN
encoding: utf-8
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN"
   "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
<html xmlns="http://www.w3.org/1999/xhtml" xml:lang="no">
	<head>
	
	<script src="/mint/?js" type="text/javascript"></script>
	
		<meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
		<meta name="author" content="Svein Reseland" />
		<meta http-equiv="content-language" content="no" />
		<title>Dekonstruksjon og rettssikkerhet</title>
		<link rel="stylesheet" type="text/css" href="css/style.css" />
<link rel='shortcut icon' href='images/favicon.ico' />
<script type="text/javascript" src="scripts/jquery-1.4.2.min.js"></script>
<script type="text/javascript" src="scripts/jquery.tooltip.min.js"></script>
<script type="text/javascript" src="scripts/ddaccordion.js"></script>
<script type="text/javascript" src="scripts/jquery-ui-1.7.2.min.js"></script>

<link rel="stylesheet" href="css/jquery.tooltip.css" type="text/css" />
<link rel="stylesheet" href="css/ui.tabs.css" type="text/css" />

<script type="text/javascript" src="scripts/jqscripts.js"></script>
<!--[if lt IE 8]>
<link rel="stylesheet" href="css/ie.css" media="screen,projection" type="text/css"  /><![endif]-->
<!--[if IE 6]>
<link rel="stylesheet" href="css/ie6.css" media="screen,projection" type="text/css"  />
<![endif]-->
<link rel="stylesheet" href="css/search_default.css" type="text/css" />
<script src="/mint/?js" type="text/javascript"></script>	</head>
	<body>
		<div class="container">
			<div class="header">
								<div class="top-options">
					<div class="top-nav">
						<div id="top-nav-inner">
							<ul id="top-nav-links">
								<li><a href="#midt_sok">Søk</a></li>
								<li><a href="#opplysning">Opplysning</a></li>
								<li><a href="#netthandel">Netthandel</a></li>
								<li><a href="#underholdning">Underholdning</a></li>
								<li><a href="#mobiltelefon">Mobiltelefon</a></li>
								<li><a href="#forbruker">Forbruker</a></li>
								<li><a href="#klager">Klager</a></li>
								<li><a href="#lover">Lover</a></li>
								<li><a href="#rss">RSS</a></li>
				</ul>
							<!--<div id="top-action">-->
							    <div class="loading">&nbsp;</div>
							    <div id="midt_sok">	
	<!-- Google CSE Search Box Begins -->
	 <!-- <form id="searchbox_005887114279432227207:2l7muo-7c-u" action="">	
	    <img src="http://www.google.com/coop/images/google_custom_search_smnar.gif" alt="Google Custom Search" /> <input type="hidden" name="cx" value="005887114279432227207:2l7muo-7c-u" /> <input type="hidden" name="cof" value="FORID:9" /> <input name="q" type="text" size="40" id="googlesok" class="cleardefault" value="S&oslash;k denne side (MinTankesmie.no)" />
	    <input type="submit" name="sa" value="S&oslash;k" class="knapp" />
	  </form>-->
	<!-- Google CSE Search Box Ends -->
	
	<form method="post" action="sok.php">
		<p><input type="text"
		id="sok" name="sok" size="50" value="Informasjons- og kunnskapssøk" 
		class="cleardefault" />
			<select name="sokemotor" id="sokemotor" onchange="alertSelectedIndex('sokemotor');" >
			<optgroup label="Søkemotorer - ordbøker - leksikoner - språk - medisin etc.">
				<option value="google">Søk Google (eller velg fra liste)</option>
				<option value="bing" class="addgray">Bing (Microsoft)</option>
				<option value="duckduckgosok" class="addgray">DuckDuckGo</option>
				<option value="beggeto">BOKMÅLSORDBOKA OG NYNORSKORDBOKA (begge)</option>
				<option value="ordboknoab">Det Norske Akademis ordbok / Ordbok (NOAB)</option>
				<option value="jusleksikonno">Jusleksikon.no (Jusleksikon Online er et gratis oppslagsverk (…) hjelpemiddel (…) studenter, jurister, lærere, næringsliv og offentlig forvaltning m.fl.)</option>
				<option value="oxfordadvancedlearnersdictionarycom" class="addgray">OXFORD ADVANCED LEARNER'S DICTIONARY (Engelsk ordbok)</option>
				<option value="merriamwebstersmedicaldictionarymedlineplus">MERRIAM WEBSTER'S Medical Dictionary (Medisinsk ordbok - MedlinePlus)</option>
				<option value="merriamwebstersmedicaldictionary">Merriam-Webster's Medical Dictionary (Medisinsk leksikon - UCSF Medical Center)</option>	
				<option value="wikipediabokmal" class="addgray">WIKIPEDIA (bokmål) (den frie encyklopedi / oppslagsverk)</option>
				<option value="storenorske" class="addgray">STORE NORSKE LEKSIKON - STORE MEDISINSKE LEKSIKON (SML)(Aschehoug &amp; Gyldendal) (Gratis)</option>
				<option value="wiktionaryno">Wiktionary, den frie ordboka</option>
				<option value="oerglobalsearch">OER global search (...find good learning resources)</option>
				<option value="skatt_skattelister">SØK I SKATTELISTER - Skatteetaten.no</option> 
				<option value="aksjer_aksjeeieropplysninger">SØK I AKSJEEIEROPPLYSNINGER - Skatteetaten.no (Kan bestilles på følgende måte)</option> 
				<option value="navnesok_domenenavn">Navnesøk – Domenenavn, foretaksnavn og varemerke – i ett søk</option>
				<option value="sprakradet" class="addgray">Sprakrådet (Språkrådet er statens fagorgan i språkspørsmål...)</option>
				<option value="pubmed2">PubMed (NCBI) (SØK I MEDISINSKE ARTIKLER OG STUDIER)</option>
				<option value="thefreedictionary">The Free Dictionary (provides definitions from The American Heritage Stedman's Medical Dictionary and Dorland's Medical Dictionary for Health Care Consumers)</option> 
				<option value="forkortingersprakradet">Forkortinger (Språkrådet)</option>
				<option value="akronymer" class="addgray">Akronymer (Ord som er laget av begynnelsesbokstavene...)</option>
				<option value="wolframalpha">Wolfram|Alpha</option>
				<option value="searchtwittercom" class="addgray">Search.twitter.com</option> 
				<option value="searchtfacecom">Open facebook search (Search Without Login!)</option> 
				<option value="merriammuttale" class="addgray">MERRIAM WEBSTER'S ONLINE (Engelsk ordbok) (m/uttale)</option>
				<option value="lexinsvenskengelsk">Lexin - svensk-engelsk / engelsk - svensk etc. (Skoldatanätet)</option>
				<option value="ordbogen" class="addgray">Ordbogen.com (Engelsk-dansk / Dansk-engelsk) (Årsabbonnement)</option>
				<option value="norsktyskordbok">TYSK-NORSK NORSK-TYSK ordbok (se også oversikt over alle tyske ordbøker</option> 
				<option value="merriamwebstersmedicaldictionarymedlineplus">MERRIAM WEBSTER'S Medical Dictionary (Medisinsk ordbok - MedlinePlus)</option>	
				<option value="oxfordadvancedlearnersdictionarycom" class="addgray">OXFORD ADVANCED LEARNER'S DICTIONARY (Engelsk ordbok)</option>
				<option value="pubmed2">PubMed (NCBI) (SØK I MEDISINSKE ARTIKLER OG STUDIER)</option>
				<option value="quixey" class="addgray">Quixey (search engine for apps)</option> 
				<option value="nhino">NHI.no -søk i publikumsutgaven av Legehåndboka (NEL)</option> 				
				<option value="omregnerdk" class="addgray">Omregner.dk (lengde, areal, volum, matlaging etc.)</option>
				<option value="konsumprisindeksenssb">Kalkulator - Regn ut hvor mye 1 000 kroner i 1930 tilsvarer i 2008-kroner (Konsumprisindeksen - SSB)</option> 
				<option value="searchoep" class="addgray">Offentlig elektronisk postjournal (OEP)</option>
				<option value="innsynno" class="addgray">Innsyn.no</option>
				<option value="boligpriserfinnno">Sjekk tidligere priser på boligen din (Finn.no)</option> 
				<option value="alleutgaveraftenposten" class="addgray">Søk i alle utgaver av Aftenposten – helt tilbake til 1860</option>
				<option value="atekstretriever">Mediearkiv / ATEKST (søk over 100 millioner artiklene)</option>
				<option value="vgarkivet1945" class="addgray">Søk i VG-arkivet fra 23. juni 1945 til og med gårsdagens VG!</option> 
				<option value="arkivportalen">Arkivportalen (Nasjonal søketjeneste på tvers av arkivinstitusjoners kataloger)</option> 
				<option value="beggeto" class="addgray">BOKMÅLSORDBOKA OG NYNORSKORDBOKA (begge)</option>
				<option value="sprakradet">Sprakrådet (Språkrådet er statens fagorgan i språkspørsmål...)</option>
				<option value="forkortingersprakradet" class="addgray">Forkortinger (Språkrådet)</option>
				<option value="akronymer">Akronymer (Ord som er laget av begynnelsesbokstavene...)</option>	
				<option value="altkoderspesialtegn" class="addgray">ALT-koder: Oversikt over spesialtegnene i Windows (korrekturavdelingen.no)</option>
				<option value="tabelloverhurtigtasterwiki">Tabell over hurtigtaster (Table of keyboard shortcuts) (wkipedia.org)</option>
				<option value="storenorske" class="addgray" class="addgray">STORE NORSKE LEKSIKON - STORE MEDISINSKE LEKSIKON (SML)(Aschehoug &amp; Gyldendal) (Gratis)</option>
duplicate specification of attribute "class"
Line: 111, Col: 55
…e="storenorske" class="addgray" class="addgray">STORE NORSKE LEKSIKON - STORE …
				<option value="allkunne">Allkunne</option> 
				<option value="ordnett" class="addgray">Ordnett.no (Kunnskapsforlagets spr&aring;k- og ordboktjeneste)</option>
				<option value="ordbogen" class="addgray">Ordbogen.com (Engelsk-dansk / Dansk-engelsk) (Årsabbonnement)</option>
				<option value="denstoredanske" class="addgray">DEN STORE DANSKE (Gyldendal Encyklopædien) (Gratis)</option> 
				<option value="nationalencyklopedin">Nationalencyklopedin (det klassiska nationella uppslagsverket och den alldeles nya bokupplagan NE i tre band)</option> 
				<option value="wikipedianynorsk">Nynorsk Wikipedia</option> 
				<option value="wikipediaengelsk" class="addgray">Wikipedia (engelsk)</option> 
				<option value="wikiscanner">WikiScanner (also known as Wikipedia Scanner)</option>
				<option value="googletranslatetranslatetext" class="addgray">Google Translate Text (Oversettelse av tekst, nettsider og dokumenter)</option>
				<option value="googletranslateanotherlanguage">Google Translate (Søk på andre språk)</option>
				<option value="pubmed2" class="addgray">PubMed (NCBI) (SØK I MEDISINSKE ARTIKLER OG STUDIER)</option>
				<option value="merriamwebstersmedicaldictionarymedlineplus">MERRIAM WEBSTER'S Medical Dictionary (Medisinsk ordbok - MedlinePlus)</option>	
				<option value="medilexicon" class="addgray">Medilexicon (Forkortelser og definisjoner)</option>
				<option value="medilexicondictionary">Medilexicon (Medical Dictionary, Medical Terminology)</option>
				<option value="norskmedisinsk" class="addgray">Norsk medisinsk ordbok (Samlaget)</option>
				<option value="merckmanual">Merck Manual (Medisinske ord og uttrykk)</option>
				<option value="merckmanualformobileandweb" class="addgray"> The Merck Manual for Mobile and Web (Unbound Medicine, Inc.)</option> 
				<option value="harrisonsmanualformobile">Harrison's Manual of Medicine for Mobile + Web</option> 
				<option value="tabersmedicaldictionary" class="addgray">Taber's Medical Dictionary for Mobile and Web</option> 
				<option value="it">Definisjoner av tusener av IT-relaterte ord (Whatis?com - ledende IT-leksikon) (TechTarget)</option>
				<option value="webopediacom" class="addgray">Webopedia.com (Dictionary - words, phrases and abbreviations - computer and Internet)</option>
				<option value="bibliotekformedisinoghelsefag">BIBLIOTEK FOR MEDISIN OG HELSEFAG (UiO)</option> 
				<option value="ordsidenno" class="addgray">Ordsiden.no</option>
				<option value="slangdictionary">Slang Dictionary</option> 
				<option value="urbandictionary">Urban Dictionary</option>
				<option value="wordnikcom">Wordnik (Wordnik shows definitions from multiple sources, so you can see as many different takes on a word's meaning as possible)</option> 
				<option value="slangucla" class="addgray">Schwa! Popular slang dictionary marks 20th anniversary at UCLA (newsroom.ucla.edu)</option> 
				<option value="ordvakta">Velkommen til Ordvakta! (Vet du om nye ord eller uttrykk? I så fall vil Ordvakta gjerne ha beskjed!)</option> 
				<option value="norskaviskorpus" class="addgray">Norsk aviskorpus (Ved Aksis er det samlet inn et omfattende tekstmateriale bestående av norske avistekster)</option> 
				<option value="nciku">Nciku (English to Chinese og Chinese to English - Tegn / bokstaver)</option> 
				<option value="freesportdictionary" class="addgray">Sportsleksikon - søk ord og uttrykk (sportsuttrykk) (Free Sport Dictionary)</option> 
				<option value="fotballleksikon">Fotball-leksikon (Soccer Dictionary) (Free Sport Dictionary)</option> 
				<option value="tennisleksikon" class="addgray">Tennis-leksikon (Tennis Dictionary) (Free Sport Dictionary)</option> 
				<option value="thelanguageofbaseball">The Language of Baseball - Dictionary and Research Guide</option> 
				<option value="sjakkleksikonterms" class="addgray">Sjakk-leksikon (Chess Terms Dictionary) (Free Sport Dictionary)</option> 
				<option value="sjakkleksikonterminology">Sjakk-leksikon (Chess Terminology Dictionary)</option> 
				<option value="nettavisenssjakk" class="addgray">Sjakkspråket fra A til Å (TV 2 Nettavisens sjakk-leksikon)</option> 
				<option value="merriammuttale">MERRIAM WEBSTER'S ONLINE (Engelsk ordbok) (m/uttale)</option>
				<option value="merriamlearner" class="addgray">MERRIAM-WEBSTER'S Advanced Learner's English Dictionary (m/uttale)</option> 
				<option value="oxfordadvancedlearnersdictionarycom">OXFORD ADVANCED LEARNER'S DICTIONARY (Engelsk ordbok)</option>
				<option value="cambridge" class="addgray">CAMBRIDGE ADVANCED LEARNER'S DICTIONARY (Engelsk ordbok)</option> 
				<option value="babylonsonlinedictionary">Babylon's Online Dictionary (1,400 dictionaries in more than 75 languages)</option>
				<option value="babyloncom8new" class="addgray">Babylon.com (Gratis nedlasrting)</option> 
				<option value="englishdictionarygoogle">Google - English dictionary</option> 
				<option value="googletranslationcenter" class="addgray">Google Translator Toolkit (Translate faster with Google's online tools)</option> 
				<option value="sayitinenglish">Say it in English, hear it in Mandarin! (tolker online mellom kinesisk og engelsk, fra alle telefoner)</option> 
				<option value="googlefightfinland" class="addgray">Googlefight (Sjekk antall treff - "dessverre" vs. "desverre")</option>
				<option value="googletrends">Google Trends (Se hva verden søker etter)</option>
				<option value="lingro">lingro (The coolest dictionary known to hombre!)</option>
				<option value="regnummerstatensvegvesen" class="addgray">Sjekk hvem eier bilen - Send REGNR til 2282 (SMS - Statens vegvesen)</option> 
				<option value="sjekkheftelserbronnoysund">Sjekk heftelser bruktbiler, motorsykler etc. (Brønnøysundregistrene)</option> 
				<option value="knol" class="addgray">Knol (A unit of knowledge) (Google)</option> 
				<option value="medstory">Medstory (health and medicine)</option>
				<option value="encyclopediaofLife" class="addgray">Encyclopedia of Life</option>  
				<option value="similarimages">Similar Images (Refine your image search with visual similarity)</option> 
				<option value="googlebildesokimagesface" class="addgray">Google "Face" (Ansiktssøk) (Images)</option>
				<option value="thevisualdictionary">THE VISUAL DICTIONARY (Matthew Knight)</option>
				<option value="thevisualdictionaryonline" class="addgray">VISUAL DICTIONARY Online (MERRIAM WEBSTER)</option> 
				<option value="blinkxcom">Blinkx.com (18 million hours of video content. Search it all)</option>
				<option value="flicrsearch" class="addgray">Flickr (almost certainly the best online photo management and sharing application in the world)</option>
				<option value="googlebildesokimages">Google Bildesøk (Images)</option>
				<option value="waybackmachine" class="addgray">Internet archive (IA) (Wayback Machine - Take Me Back)</option>
				</optgroup>
			<optgroup label="Diverse - ordbøker (Engelsk-norsk etc.), IT, leksikoner, medisinske artikler, studier, matematikk etc.">
				<option value="begge">Bokm&aring;lsordboka og Nynorskordboka (begge)</option>
				<option value="googlefight">Googlefight (Sjekk hvilket søkeord, f.eks. av "jeg" og "meg", som får flest treff)</option>
				<option value="wordle">Wordle (a toy for generating word clouds from text that you provide)</option>
				<option value="ordnett">Ordnett.no (Kunnskapsforlagets spr&aring;k- og ordboktjeneste)</option>
				<option value="ordbogen" class="addgray">Ordbogen.com (Engelsk-dansk / Dansk-engelsk) (Årsabbonnement)</option>
				<option value="omregnerdk">Omregner.dk (lengde, areal, volum, matlaging etc.)</option>	
				<option value="it">Definisjoner av tusener av IT-relaterte ord (Whatis?com - ledende IT-leksikon) (TechTarget)</option>
				<option value="merriammuttale">Merriam Webster's Online (Engelsk ordbok)</option>
				<option value="oxford">Oxford Advanced Learner's Dictionary (Engelsk ordbok)</option>
				<option value="cambridge">Cambridge Advanced Learner's Dictionary (Engelsk ordbok)</option>
				<option value="nhino">NHI.no - søk i publikumsutgaven av Legehåndboka (NEL)</option> 
				<option value="dictionaryofcancerterms">Dictionary of Cancer Terms (National Cancer Institute)</option>
				<option value="pubmed2">PubMed (NCBI) (S&oslash;k i medisinske artikler og studier)</option>
				<option value="merriamwebstersmedicaldictionary">Merriam-Webster's Medical Dictionary (Medisinsk leksikon - UCSF Medical Center)</option>	
				<option value="medilexicon">Medilexicon (Forkortelser og definisjoner)</option>
				<option value="merckmanual">Merck Manual (Medisinske ord og uttrykk)</option>
				<option value="medicinenetsearch">MedicineNet (Medisinske ord og uttrykk)</option> 
				<option value="medlinepplus40">MedlinePlus (Health Information in Multiple Languages) (National Library of Medicine)</option> 
				<option value="relemed">ReleMed (Search millions of biomedical articles for the most relevant answers)</option>
				<option value="akronymer">Akronymer (Ord som er laget av begynnelsesbokstavene...)</option>	
				<option value="webopediacom">Webopedia.com (Dictionary - words, phrases and abbreviations - computer and Internet)</option>
				<option value="lexinnorskengelsk">Lexin - norsk-engelsk (Utdanningsdirektoratet, AKSIS 2006)</option>
				<option value="lexinsvenskengelsk">Lexin - svensk-engelsk / engelsk - svensk etc. (Skoldatanätet)</option>
				<option value="bazar">Bazar (Bazar er en skreddersydd tjeneste for språklige minoriteter i Norge)</option> 
				<option value="merriammuttale">Merriam Webster's Online (Engelsk ordbok)</option>
				<option value="britannica">Encyclop&aelig;dia Britannica (Engelskspr&aring;klig leksikon)</option>					
				<option value="bartlebynettleksikon">Bartleby.com - nettleksikon (Columbia Encyclopedia)</option>
				<option value="financialdictionary">INVESTORS.com (Financial Dictionary)</option>
				<option value="markedsforing">Dictionary of Marketing Terms (Markedsf&oslash;ringsuttrykk)</option>
				<option value="engelskokonomiskordbokonline">Engelsk økonomisk ordbok online (Engelsk-norsk/norsk-engelsk - se Ordnett.no)</option>
				<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option>
				<option value="dictionarylaw">The People's Law Dictionary (LAW.COM.Dictionary)</option>
				<option value="ordlistematematikk">Engelsk-norsk ordliste i matematikk (Matematisk institutt, Universitetet i Oslo)</option>	
				<option value="mathworld">MathWorld (The Web's Most Extensive Mathematics Resource)</option>		
				<option value="militarordbok">The official dictionary of military terms (United States. Joint Chiefs of Staff.)</option>
				<option value="fotoordlistedinside">Foto-ordliste (DinSide)</option>
				<option value="fruktno">Frukt.no (fruktleksikon)</option>
				<option value="artcyclopediacom">Artcyclopedia.com (is the guide to great art on the Internet)</option>
				</optgroup>
			<optgroup label="Diverse spesialsøkemotorer (se også linker nederst på denne siden)">
				<option value="wordiacom">wordia.com (a new kind of dictionary - a democratic visual dictionary)</option> 
				<option value="mnemomap">mnemomap (a new way to search the internet)</option>
				<option value="twingly">Twingly (a spam-free blog search engine)</option>
				<option value="topixnet">Topix.net (ability to quickly and easily find targeted news on the Internet)</option>
				<option value="flicrtagspacetagnautica">Flicr Tag Space (Tagnautica is an experimental navigation tool built to explore the space of related Flickr tags)</option>
				<option value="ajaxwhoiscom">Ajaxwhois.com (service for finding available domain names)</option>
				<option value="whoswhowikipedia">Who's Who From Wikipedia, the free encyclopedia</option> 
				<option value="flickrstorm">FlickrStorm (FlickrStorm is a better search for Flickr!)</option>
				<option value="keotag">Keotag (tag search multiple engines and tag generators)</option>
				<option value="similicious">similicio.us (If you find a good article - try copying and pasting the full URL)</option>
				<option value="whonu">whonu (the power of all these great search tools into a single interface)</option>
				<option value="kwmap">KwMap.net (A Keyword Generating Tool for Information Literacy Instruction)</option>
				<option value="waybackmachine">Internet archive (Wayback Machine - Take Me Back)</option>
				</optgroup>
			<optgroup label="Norske ordb&oslash;ker, oversettere etc.">		
				<option value="begge">Bokm&aring;lsordboka og Nynorskordboka (begge)</option>
				<option value="sprakradet">Sprakrådet (Språkrådet er statens fagorgan i språkspørsmål...)</option>
				<option value="ordbokstortinget">Ordbok - Norsk-Engelsk ordliste (Her finner du forklaring på begreper som ofte brukes innen politikk)</option> 
				<option value="taeganpoliticaldictionary">Politicaldictionary.com (Taegan Goddard's Political Dictionary)</option> 
				<option value="dengronneordbokapanettet">"Den grønne ordboka - på nettet" har ca. 25.000 oppslagsord på norsk, engelsk, tysk og latin</option>
				<option value="ordibibelen">Søk etter ord i Bibelen (Det teologiske Menighetsfakultet)</option>
				<option value="typisknorsk">Typisk norsk (NRK)</option>
				<option value="peregilheggedagenssporsmal">Dagens spørsmål til Per Egil Hegge (Aftenposten)</option>
				<option value="forfatterportalen">Forfatterportalen.no (Oppslagsverk - norsk, engelsk, latin etc.)</option>
				<option value="norskordbok">Norsk ordbok</option>
				<option value="tekstlaboratoriet">Tekstlaboratoriet (en enhet ved Institutt for lingvistiske og nordiske studier - UiO)</option>				
				<option value="googletranslatetranslatetext">Google Translate Text (Oversettelse av tekst, nettsider og dokumenter)</option>
				<option value="googletranslateanotherlanguage">Google Translate (Søk på andre språk)</option>
				</optgroup>
			<optgroup label="Diverse ordbøker og leksikon (Oppslagsverk)">
				<option value="storenorske">STORE NORSKE LEKSIKON - STORE MEDISINSKE LEKSIKON (SML)(Aschehoug &amp; Gyldendal) (Gratis)</option>
				<option value="wikipedia">Wikipedia (den frie encyklopedi / oppslagsverk)</option>
				<option value="caplex">Caplex nettleksikon (J.W. Cappelens Forlag AS)</option>
				<option value="dictionarycom">Dictionary.com</option> 
				<option value="britannica">Encyclop&aelig;dia Britannica (Engelskspr&aring;klig leksikon)</option>					
				<option value="bartlebynettleksikon">Bartleby.com - nettleksikon (Columbia Encyclopedia)</option>
				<option value="dictionaryofman">Dictionary of Man (Bob Geldof: Målet er å dokumentere samtlige kulturer over hele verden, i form av lyd, bilder og tekst.)</option>
				<option value="msnencarta">MSN Encarta (Online Encyclopedia, Dictionary, Atlas, and Homework)</option>
				<option value="chambers">Chambers Reference Online - 21st Century Dictionary (500 new words - published since 1861)</option>
				<option value="referencecom">Reference.com (Language reference products and services on the Internet)</option>
				<option value="iriverd25">iRiver D25 electronic dictionary: one step towards the universal translator</option>
				<option value="collinsfreedictionarysearch">Collins (Free Dictionary Search)</option> 
				<option value="collinselectronicdictionaries">Collins electronic dictionaries (powered by Lexibase technology)</option>
				<option value="penguinbooks">Penguin Books (dictionary)</option> 
				<option value="thefreedictionarycom">TheFreeDictionary.Com</option>
				<option value="thedictionarycom">The Dictionary</option> 
				<option value="lexicopublishinggroup">Lexico Publishing Group, LLC</option> 
				<option value="finditcom">Findit.com (Diverse oppslagsmuligheter)</option>
				<option value="theuniversaltranslator">The universal translator is a science fiction technology...</option>
				<option value="artlexartdictionary">ArtLex - Art Dictionary (for artists, collectors, students and educators in art production...)</option>
				<option value="groveartonline">Grove Art Online (The Dictionary of Art and The Oxford Companion to Western Art)</option>
				<option value="artcyclopediacom">Artcyclopedia.com (is the guide to great art on the Internet)</option>
				<option value="meteorologileksikon">Meteorologileksikon (Meteorologisk institutt)</option>
				<option value="geoleksi">GeoLeksi (Geologisk leksikon - Inge Bryhni - Geologisk museum i Oslo)</option>
				<option value="slikleksikonorg">Slikleksikon.org (- viden feder ikke)</option>
				<option value="freebibledictionary">The free Bible Dictionary (www.bible-dictionary.org) (Babylon.com)</option>
				<option value="codexsinaiticus">Codex Sinaiticus (Verdens eldste bibel - online)</option> 
				</optgroup>
			<optgroup label="Økonomi- og finansordbøker">
				<option value="norgesbankordogutrykk">Norges Bank (Ord og uttrykk)</option>
				<option value="ubsdctionaryofbanking">UBS Dictionary of Banking (UBS is one of the world's leading finacial firms)</option> 
				<option value="financialdictionary">INVESTORS.com (Financial Dictionary)</option>
				<option value="investopediacom">Investopedia.com</option> 
				<option value="engelskokonomiskordbokonline">Engelsk økonomisk ordbok online (Engelsk-norsk/norsk-engelsk)</option>
				<option value="investmentermscom">Investmenterms.com</option> 
				</optgroup>
			<optgroup label="Diverse ordboksamlinger - flere hundre språk - ordbøker for invandrere">
				<option value="nordisk">Norsk / Nordisk ordboksamling (ivarmedia.as)</option>
				<option value="intertran">InterTran.com (Translate between 1,600 language pairs) (bl.a. engelsk - latin)</option>
				<option value="babelfish">Babel Fish Oversett (Velg fra og til spr&aring;k)</option>				
				<option value="fleresprak">Ordb&oslash;ker for 300 spr&aring;k (yourDictionary.com)</option>
				<option value="lexinnorskengelsk">LEXIN - ordb&oslash;ker for invandrere (Utdanningsdirektoratet, AKSIS 2006)</option>
				<option value="tomisimo">Tomisimo - Spanish English Dictionary (Use Tomisimo on your Cellphone or PDA)</option>
				<option value="englishmaltesedictionary">English Maltese Dictionary (malta.atspace.com)</option>
				<option value="enhancedenglishmaltesedictionary">Enhanced English Maltese Dictionary (maltadictionary.com)</option>
				<option value="franklincom">Franklin Electronic Publishers (...electronic language learning solutions...)</option>
				</optgroup>							
			<optgroup label="Diverse engelske - amerikanske ordb&oslash;ker (Engelsk-engelsk) - tyske ordbøker">
				<option value="cambridge">Cambridge Advanced Learner's Dictionary (Engelsk ordbok)</option>
				<option value="merriammuttale">Merriam Webster's Online (Engelsk ordbok)</option>
				<option value="merriamipod">Merriam Webster's for nedlasting til IPOD (Engelsk ordbok)</option>
				<option value="merriamusb">Merriam Webster USB Dictionary and Thesaurus (Engelsk ordbok)</option>
				<option value="merriamusbmp3">Merriam-Webster® Dictionary &amp; MP3 Player (MWD-480) (Engelsk ordbok)</option>
				<option value="oxford">Oxford Advanced Learner's Dictionary (Engelsk ordbok)</option>
				<option value="oxfordonline">Oxford University Press (Oxford online)</option>
				<option value="microsoftbooks">Microsoft eBooks for nedlasting (Engelsk, fransk... ordbok)</option>
				<option value="urbandictionary">Urban Dictionary</option>
				<option value="slangdictionary">Slang Dictionary</option> 
				<option value="thegotateenager">The Gotateenager website (An online dictionary to bridge the gap between parents and teens)</option> 
				<option value="freebibledictionary">The free Bible Dictionary (www.bible-dictionary.org) (Babylon.com)</option>
				</optgroup>
			<optgroup label="Matematikk, omregnere, det Periodiske system etc">
				<option value="omregnerdk">Omregner.dk (lengde, areal, volum, matlaging etc.)</option>		
				<option value="martindalescalculators">Martindale's calculators on-line center (Diverse kalkulatorer)</option>
				<option value="refdesk">REFDESK - "The single best source for facts on the Net"</option> 
				<option value="ordlistematematikk">Engelsk-norsk ordliste i matematikk (Matematisk institutt, Universitetet i Oslo)</option>	
				<option value="mathworld">MathWorld (The Web's Most Extensive Mathematics Resource)</option>
				<option value="oxforddictionaryofathematics">The Concise Oxford Dictionary of Mathematics</option> 
				<option value="detperiodiskesystem">Grunnstoffenes periodiske system - Det periodiske system (Wikipedia)</option> 
				<option value="periodicchartlenntech">Periodic chart of elements (Lenntech)</option> 
				</optgroup>
			<optgroup label="Aviser, tidsskrifter, magasiner, tekstarkiv for aviser etc.">	
				<option value="onlineaviserno">Onlineaviser.no (Aviser, tidsskrifter, magasiner...)</option>
				<option value="atekst">Mediearkiv / ATEKST (søk over 100 millioner artiklene)</option>
				<option value="aftenpostenordoguttrykk">Ord og uttrykk (RADAR - Aftenpostens medielab)</option>
				<option value="aftenpostenleksehjelp">Leksehjelp (RADAR - Aftenpostens medielab)</option>
				<option value="newsbank">NewsBank (one of the world's premier information providers for more than 35 years)</option>
				<option value="newslibrarycom">NewsLibrary.com (1318 newspapers and other news sources make  the ideal tool for news research.)</option>
				</optgroup>
			<optgroup label="S&oslash;k i engelskspr&aring;klige medisinske artikler og studier">	
				<option value="pubmed2">PubMed (NCBI) (S&oslash;k i medisinske artikler og studier)</option>
				</optgroup>	
			<optgroup label="Medisinske ord og uttrykk (Oppslagsverk)">	
				<option value="merckmanual">Merck Manual (Medisinske ord og uttrykk)</option>
				<option value="nhino">NHI.no -søk i publikumsutgaven av Legehåndboka (NEL)</option> 				
				<option value="norskmedisinsk">Norsk medisinsk ordbok (Samlaget)</option>
				<option value="medicaldictionary">MedlinePlus (NIH) Medical Dictionary (Medisinsk ordbok)</option>					
				<option value="norsklegemiddelhandbok">Norsk legemiddelhåndbok (oppslagsbok om legemidler)</option>
				<option value="medisinerlatin">Medicinska termer ("medisinerlatin") (Karolinska Institutet - Latin och grekiska till svenska)</option>
				<option value="medicaldictionary">MedlinePlus (NIH) Medical Dictionary (Medisinsk ordbok)</option>					
				<option value="medicalencyclopedia">MedlinePlus (NIH) Medical Encyclopedia (Medisinsk leksikon)</option>	
				<option value="merriamwebstersmedicaldictionary">Merriam-Webster's Medical Dictionary (Medisinsk leksikon - UCSF Medical Center)</option>			
				<option value="stedmans">Stedman's Medical Dictionaries (The Best Words in Medicine)</option>				
				<option value="dorlands">the Dorland's Illustrated Medical Dictionary (Online Dictionary)</option> 
				<option value="biodictionary">Bio Dictionary (nottingham.ac.uk)</option> 
				<option value="teendrugslang">Teen Drug Slang: A Dictionary For Parents (cbsnews.com)</option>
				<option value="dictionaryforparentsofchildrenwithdisabilities">Dictionary for Parents of Children with Disabilities  (Center for disabilities)</option>
				<option value="downloaddictionaryforparentsofchildrenwithdisabilities">Download the Dictionary for Parents of Children with Disabilities  (Center for disabilities)</option>
				</optgroup>
			<optgroup label="Medisinske forkortelser og akronymer">
				<option value="medilexicon">Medilexicon (Forkortelser og definisjoner)</option>	
				</optgroup>
			<optgroup label="Akronymer">
				<option value="akronymer">Akronymer (Ord som er laget av begynnelsesbokstavene...)</option>
				</optgroup>
			<optgroup label="Biblioteksvar - Norge, Sverige, Danmark, Finland...">
				<option value="biblioteksvarnorge">Spør Biblioteksvar på SMS, chat, e-post - Søk i Biblioteksvars base - Norge)</option>
				<option value="biblioteksvardanmark">Spørg Biblioteksvagten (- Danmark)</option>
				<option value="biblioteksvarsverige">Fråga biblioteket (- Sverige)</option>
				<option value="biblioteksvarandre">Spør diverse bibliotek (- Finland, England, Tyskland, USA, Spania, Frankrike...)</option>
				</optgroup>
			<optgroup label="Foto-ordliste">	
				<option value="fotoordlistedinside">Foto-ordliste (DinSide)</option>
				<option value="fotoordlisteapressen">Foto-ordliste (A-Pressen ASA)</option>
				</optgroup>
			<optgroup label="PC, data - IT - sikkerhet - digital fjernsynsteknologi">	
				<option value="techencyclopedia">TechEncyclopedia - More than 20,000 IT terms (TechWeb)</option>
				<option value="processLibrarycom">ProcessLibrary.com (finn ut hvilke prosesser som kjører på din PC)</option>
				<option value="webopediacom">Webopedia.com (Dictionary - words, phrases and abbreviations - computer and Internet)</option>
				<option value="it">Definisjoner av tusener av IT-relaterte ord (Whatis?com - ledende IT-leksikon) (TechTarget)</option>
				<option value="thenewhackersdictionary">The New Hacker's Dictionary (This document is a collection of slang terms used by various subcultures of computer hackers)</option>
				<option value="sikkerhetspedia">Sikkerhetspedia (Norsk senter for informasjonssikring (NorSIS)</option>
				<option value="digitalordbok">Digital ordbok (Norges televisjon as)</option>
				</optgroup>
			<optgroup label="Markedsf&oslash;ring-ordliste">	
				<option value="markedsforing">Dictionary of Marketing Terms (Markedsf&oslash;ringsuttrykk)</option>
				</optgroup>
			<optgroup label="Programvarekoder">
				<option value="krugle">Krugle (Programvarekoder - for utviklere etc.)</option>
				<option value="inventiviohelp4j">Help4j - Knowledge for Experts (kode-eksempler for Java)</option> 
				<option value="koders">Koders (is the leading search engine for open source code)</option>
				<option value="googlecodesearch">Google Code Search (Search public source code)</option>
				</optgroup>
			<optgroup label="Juridiske ordlister (Juss) - norsk / engelsk">	
				<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option>
				<option value="dictionarylaw">The People's Law Dictionary (LAW.COM.Dictionary)</option>
				<option value="forkortelsesregisterjuss">Forkortelsesregister (Juss)</option>
				</optgroup>		
			<optgroup label="Politikk - Norge">
				<option value="komiteenestortinget">Representanter og komiteer</option>
				<option value="statsbudsjettetstortinget">Statsbudsjettet 2010</option> 
				<option value="stoltenberg">Statsministerens kontor (SMK) - Regjeringen Stoltenberg II</option>
				<option value="innstillingerstortinget">Innstillinger (Innstillinger er komiteens forslag til vedtak i Stortinget)</option>
				<option value="opnehoringerstortingetarkiv">Møter og åpne høringer på nett-TV (ARKIV - planlagte og avholdte åpne høringer) (NRK.no)</option> 
				<option value="partipolitikkstortinget">Representanter og partigrupper (Her finner du informasjon om hvordan du kan kontakte stortingsrepresentantene og partigruppene)</option>
				<option value="politiskesaker1">Stortinget Saker og publikasjoner</option>
				<option value="politiskesaker2">Stortinget (S&oslash;k i sp&oslash;rsm&aring;l og interpellasjoner - register tilbake til 1989)</option>
				<option value="ordbokstortinget">Ordbok - Norsk-Engelsk ordliste (Her finner du forklaring på begreper som ofte brukes innen politikk)</option> 
				<option value="taeganpoliticaldictionary">Politicaldictionary.com (Taegan Goddard's Political Dictionary)</option> 
				</optgroup>
			<optgroup label="Utenrikspolitikk">
				<option value="thelibraryofcongress">The Library of Congress (USA)</option>
				<option value="thelibraryofcongressabout"> The Library of Congress (About)</option>
				<option value="youchoose08">You Choose '08 (official Web videos from Hillary Clinton, Rudy Giuliani, Barack Obama et al., listed on one page)</option>
				</optgroup>
			<optgroup label="Militære ord og uttrykk (Oppslagsverk)">	
				<option value="militarordbok">The official dictionary of military terms (United States. Joint Chiefs of Staff.)</option>
				<option value="dodictionary">The DOD Dictionary and the Joint Acronyms and Abbreviations (Joint Electronic Library)</option>
				</optgroup>
			<optgroup label="Diverse s&oslash;kemotorer etc.">
				<option value="quixey">Quixey (search engine for apps)</option>
				<option value="yandexcom">Yandex</option> 
				<option value="wolframalpha">Wolfram|Alpha</option> 
				<option value="blekko">blekko</option>
				<option value="greplin">Greplin</option> 
				<option value="aardvark">Aardvark (Get live answers from your friends (and their friends)</option> 
				<option value="kosmix">Kosmix</option> 
				<option value="blackgoogle">Black Google Would Save 750 Megawatt-hours a Year</option>
				<option value="blackdust">Blackdust is an anonymous Google proxy - for the freedom fighter in you</option>
				<option value="sputtr">Sputtr (a collection of all your favorite search engines - all on just one page!)</option>
				<option value="searchme">Searchme</option> 
				<option value="viewzi">Viewzi (At Viewzi, we think great things are made by great people)</option> 
				<option value="redzee">RedZee (The idea that complex stories can be told with just a single still image, or that an image can replace huge amounts of text?)</option> 
				<option value="pixsta">Pixsta</option> 
				<option value="Endecacom">Endeca</option>
				<option value="spacetime">SpaceTime</option> 
				<option value="kvasir">Kvasir (Eniro Norge AS)</option>		
				<option value="derdubor">Derdubor (TV2 og A-pressen)</option> 
				<option value="bookfindercomsok">BookFinder.com (se også "Netthandel" etc)</option>
				<option value="questia">Questia (The World's Largest Online Library of Books)</option>
				<option value="technoratisearch">Technorati (the recognized authority on what's happening on the World Live Web, right now)</option>
				<option value="tafiti">Tafiti (an experimental search front-end from Microsoft)</option>	
				<option value="citizendium">Citizendium (The Citizen's Compendium)</option>	
				<option value="stumbleupon">StumbleUpon</option> 
				<option value="twingly">Twingly (a spam-free blog search engine)</option>
				<option value="baidu">Baidu (Kinas største søkemotor)</option>
				<option value="pandiasearchsentral">Pandia Search sentral (has all you need to know about search engines, Internet searching and search engine marketing)</option>
				<option value="prefound">PreFound (Think of PreFound.com as the ultimate search blog)</option>	
				<option value="hakia">hakia Search Engine (the Web's new "meaning-based" search engine)</option>		
				<option value="yelo">Yelo (Eniro Norge AS)</option>		
				<option value="viddi">Viddi (Scan Venture Oslo AS)</option>
				<option value="accoona">Accoona (provides users with better web, business and news results)</option>		
				<option value="opensearch">OpenSearch Search More at Once (Live Search)</option>
				<option value="accessiblewebsearch">Google (Enklere websøk for svaksynte)</option>
				<option value="googleoyoy">Google - oy-oy.eu (Sammenlign Google-resultater fra forskjellige geografiske steder)</option>
				<option value="allthewebcom">AlltheWeb.com (AlltheWeb's index (provided by Yahoo!) includes billions of web pages...)</option>
				<option value="aolsearch">AOL Search (AOL)</option>
				<option value="newsarchivesearch">Google News Archive Search (An easy way to search and explore historical archives)</option> 
				<option value="metacrawler">MetaCrawler (MetaCrawler is simply the easiest way to find better search...)</option>
				<option value="alexa">Alexa Internet (Web Discovery Machine)</option>
				<option value="chacha">ChaCha Search (ChaCha Search, Inc. Experimental Use)</option>
				<option value="dogpile">Dogpile (Dogpile was built to give users the best search results available on the Web)</option>
				<option value="extremetracker">eXTReMe Tracker (get every advanced feature required to picture the visitors of your website)</option>
				<option value="yahoo">Yahoo (Yahoo! Inc.)</option>
				<option value="pharmaceuticalindustrysearchengine">PharmaLiveSearch.com - Quick access to the only pharmaceutical industry search engine</option> 
				</optgroup>
		</select>
			<input type="submit" value="S&oslash;k" class="knapp" />
		</p>		
	</form>
</div>							    <div id="opplysning"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Opplysning - retningsnummer (landkoder), poatadresser, kart, ruteopplysning, reiser, post, skole etc.</option>
		<optgroup label="Landkoder, posten, postnummer, poststedsnavn og pakkesporing i Norge, Sverige og Danmark etc.">
			<option value="retningsnummerutland" class="addgray">Landkoder (Slik ringer du til utlandet - tast 00 + landkode + retningsnummer + nummer du vil ringe)</option>
			<option value="frimerkerporto">Frimerker - vekt - porto (ett A4 ark veier ca. 5 gram) (Bring.no)</option>
			<option value="digipostposten" class="addgray">Digipost.no - Ta i bruk din nye digitale postkasse! (posten.no/digipost)</option> 
			<option value="egendigitalepostkassse">Nå får du din egen digitale postkasse hos Posten (digi.no 12.1.2011)</option> 
			<option value="tilbudswebno">tilbudsweb.no (Velg selv hvilken reklame og hvilke tilbud du vil ha!)</option> 
			<option value="postenn" class="addgray">Søk postnummer og poststedsnavn i Norge (Posten)</option>
			<option value="postendk">Danmark, Færøerne og Grønland (Post Danmark A/S)</option>
			<option value="postens">Sverige (Posten)</option>
			<option value="uspostalservice">USPS - The United States Postal Service (U.S. Postal Service)</option>
			</optgroup>
		<optgroup label="Opplysning, nødnummer, retningsnummer (landkoder), kart etc.">
			<option value="retningsnummerutland" class="addgray">Landkoder (Slik ringer du til utlandet - tast 00 + landkode + retningsnummer + nummer du vil ringe)</option>
			<option value="nodnumrene">Nødnumrene - BRANN 110 - POLITI 112 - AMBULANSE 113</option> 
			<option value="utenlandskenodnummer" class="addgray">Utenlandske nødnummer</option> 
			<option value="1882forutlandet">1882 (for utlandet)</option> 
			<option value="2100smstjeneste">2100 (sms-tjeneste)</option> 
			<option value="gulesiderkartflyyfoto" class="addgray">Gule Sider - kart, flyfoto etc. (Findexa AS - Telenors offisielle katalogutgiver)</option>
			<option value="180no">180.no nummeropplysning</option> 
			<option value="opplysningen1881">Opplysningen 1881 (person, firma, kartsøk etc.)</option>
			<option value="1888varsagod" class="addgray">1888 Værsågod!</option> 
			<option value="opplysning1890">Opplysning 1890 (hjelper deg med navn, numre og adresser) (EasyConnect AS)</option>
			<option value="googlemaps">Google Maps - Kart, satellitt etc.</option>
			<option value="msmaps">Bing Maps - Kart, satellitt etc.</option>
			<option value="healthmapglobaldiseasealertmap">HealthMap - Global disease alert map</option> 
			<option value="gulesider">Gule Sider (Findexa AS - Telenors offisielle katalogutgiver)</option>
			<option value="gulnoas">Gul.no (Gul.no AS)</option> 
			<option value="gulexdk">gulex.dk (søk i Danmark, Norge og Sverige)</option>
			<option value="yahoolocalmaps">Yahoo! Local Maps - Kart, satellitt etc.</option>
			<option value="googleearth">Google Earth - A 3D interface to the planet (Program for nedlasting)</option>		
			<option value="kartsesamno3d">Finn - 3D-kart</option> 
			<option value="seamgatebilder">Finn gatebilder</option> 
			<option value="googlecalculator3" class="addgray">Valutakurser (Norges Bank)</option>
			<option value="telepriserno">telepriser.no - sammenlign priser for fasttelefon, mobiltelefoni og Internett</option>
			<option value="tollogavgiftsdirektoratet" class="addgray">Toll og avgiftsdirektoratet</option>
			<option value="bevispengebruk10ar">Tollvesenet får kreve bevis på din pengebruk i utlandet 10 år tilbake (aftenposten.no 11.5.2012)</option> 
			<option value="googlecalculator2">Google calculator (Bruk søkefelt fra Google som valutaomregner)</option>
			<option value="omregnerdk" class="addgray">Omregner.dk (lengde, areal, volum, matlaging etc.)</option>	
			<option value="proff">Proff - bedrifter og privatpersoner (Findexa Proff Telefonkatalogen Gule Sider)</option>		
			<option value="anywho" class="addgray">AnyWho (FIND A PERSON - FIND A BUSINESS)</option>	
			<option value="whitepagescom">WhitePages.com (contact information in the United States and Canada)</option>		
			<option value="teldir">Teldir (Find anyone anywhere in the world)</option>
			<option value="teldirdialingcodes">Teldir (International dialing Codes - anywhere in the world)</option>
			<option value="infospace">InfoSpace (a leader in mobile entertainment, private-label search and online directory)</option>
			<option value="searchsystemsnet">Searchsystems.net (Now over 38,097 Searchable Public Record Databases!)</option>
			<option value="sokkartfinnno">Finn.no (søk på kart etc.)</option>
			<option value="sokkartzettno">Zett.no (søk på kart etc.)</option>
			<option value="map24">map24 (Ruteplanlegger - last ned kart til mobiltelefon etc.)</option>
			<option value="mobilegmaps">Mobile GMaps (All About Symbian - Feed Your Phone)</option>				
			<option value="mapquest">MapQuest.com Information Center</option>
			<option value="maporama">Maporama International (The European leader on the market of Geocentric Services)</option>
			<option value="mapscom">Maps.com (a leading provider of mapping products and solutions to business, education and consumer markets)</option>
			</optgroup>
		<optgroup label="Rute- og reiseinformasjon - ankomst- og avgangstider - planlegging">
			<option value="flightstats">Flightstats - informasjon om flyturen</option> 
			<option value="trafikanten">Trafikanten (Rute- og reiseinformasjon for Akershus, Oslo og sentrale østlandet)</option>
			<option value="ruteopplysning">Ruteopplysningen 177 - fylkene (Tjenesten er drevet av Foreningen 177)</option>
			<option value="nsb">NSB (Persontrafikk med tog og buss, samt godstrafikk på jernbane...)</option>
			<option value="ruteplanleggeren">NRK (Her finner du lenker til gode ruteplanleggere)</option>
			</optgroup>		
		<optgroup label="Tid, reiser, GPS, UDs landsider, skikk og bruk etc.">
			<option value="verdensuret">Verdensuret (Time and Date AS)</option>
			<option value="helsetipsreseptbelagtelegemidler">Helsetips reiser og reseptbelagte legemidler - Health Tip: Traveling With Prescription Medications</option> 
			<option value="restplassno">restplass.no (Registrer deg gratis i Norges største reiseklubb for gode reisetilbud)</option>
			<option value="reiseklinikken">Reiseklinikken.no (Reisemedisin er ikke bare vaksinering)</option> 
			<option value="momondo">Momondo (Helps you find cheap flights instantly)</option>
			<option value="orbville">Orbville.no</option> 
			<option value="kayak">Kayak</option> 
			<option value="verdensbesteflyselskaper">Verdens beste flyselskaper (Forbes)</option>
			<option value="verdensbilligsteflyselskaper">Verdens beste billig-flyselskaper (Forbes)</option>
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			<option value="timeleft">TimeLeft (a free clock, reminder, alarm clock, tray clock, countdown clock, stopwatch, timer...)</option>
			<option value="flybussekspressenas">Flybussekspressen AS (til/fra flyplassen)</option>
			<option value="sasbraathens">SAS Braathens (Planlegg og bestill flyreise)</option>
			<option value="norwegian">Norwegian Air Shuttle (Lavpriskalenderen)</option>
			<option value="kelkoo">kelkoo (Flybilletter)</option>
			<option value="dinsidereise">DinSide Reise</option>
			<option value="reisefeber">Reisefeber.no</option>
			<option value="nordnorgesguidenno">Nordnorgesguiden.no</option> 
			<option value="boocom">Boo.com (a new type of travel website that will help change the way you search for travel online)</option>
			<option value="flybilligstcom">flybilligst.com (et verktøy som hjelper deg å finne de billigste flybillettene)</option>
			<option value="solfaktoras">SOLFAKTOR AS - søk blant feriereiser og restplasser fra samtlige nordiske charteroperatører og utvalgte lavpris flyselskap</option>
			<option value="skyeuropeairlines">SkyEurope Airlines (The Gateway to Central Europe!)</option>
			<option value="ebookersno">ebookersno (Europas største reisebyrå på Internett)</option>
			<option value="sidestep">SideStep (Find the best bargains from multiple travel sites)</option>
			<option value="globalhotelindex">Global Hotelindex (Integrates Google-Maps for user friendliness)</option>
			<option value="tomtom">TomTom (a leading provider of personal navigation products and services)</option>
			<option value="garmin">Garmin (en av verdens største produsenter av GPS-produkter)</option>
			<option value="wayfindercom">Wayfinder.com (Kart-, vägvisnings- och GPS-navigeringstjänster för mobiltelefoner)</option>
			<option value="reisevaksinerhvilketrengs1">Reisevaksiner hvilke trengs? (Tidsskriftet)</option>
			<option value="reisevaksinerhvilketrengs2">Vet du om du trenger vaksiner før neste ferietur? (Aftenposten.no)</option>
			<option value="dinsidesvaksinekalkulator">Hvilke vaksiner trenger du? (DinSides vaksinekalkulator)</option>
			<option value="reisevaksinerfor2000kroner">2000 kroner for ferievaksiner (Aftenposten.no)</option>
			<option value="forbesmostdangerousdestinations">Forbes Most Dangerous Destinations 2007</option>
			<option value="elkjopfotofremkalling">Elkjøp Fotofremkalling (Nordens største handelsforetak innen forbrukerelektronikk)</option>
			<option value="lefdalcomfotofremkalling">Lefdal Digitale fargebilder (Bildene kan sendes til din private adresse eller hentes hos Lefdal)</option>
			<option value="udslandsider">UDs landsider (Utenriksdepartementet)</option>
			<option value="skikkogbrukno">Skikkogbruk.no (Kunnskapsdatabase - de skrevne/uskrevne sosiale regler...)</option>
			<option value="farvelfolkeskikk">Farvel, folkeskikk (dinside.no)</option>
			<option value="kartbutikkenno">kartbutikken.no (GPS, kart etc. - UGLAND IT GROUP AS)</option>
			<option value="gpsno">GPS.no (Nettsted for satellittbasert navigasjon - The Global Positioning System (GPS))</option>
			<option value="gpstest">GPS test (Dingz.no)</option>
			<option value="gpspakke">GPS pakke for navigering i Skandinavia (Wayfinder Navigator)</option>
			<option value="stephenpmorse">Stephen P. Morse (Converting Addresses to Latitude/Longitude in One Step)</option>
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			</optgroup>
		<optgroup label="Cruise">
			<option value="norwegianccruiseline">Norwegian Cruise Line</option>
			<option value="royalcaribbeancruiseline">Royal Caribbean Cruise Line</option>
			<option value="princesscruises">Princess Cruises</option>
			</optgroup>
		<optgroup label="Myndigheter, landinfo, kalkulatorer etc.">
			<option value="alleregistre">Alle registre (offentlighet.no)</option>
			<option value="regleromdokumentoffentlighet">Regler om dokumentoffentlighet (offentlighet.no)</option>
			<option value="landinfo">Landinfo - utlendingsforvaltningens fagenhet (Utlendingsdirektoratet (UDI))</option>
			<option value="skikkogbrukno">Skikkogbruk.no (Kunnskapsdatabase - de skrevne/uskrevne sosiale regler...)</option>
			<option value="googlecalculator1">Google calculator (Bruk søkefelt fra Google som kalkulator)</option>
			<option value="googlecalculator2">Google calculator (Bruk søkefelt fra Google som valutaomregner)</option>
			<option value="kalkulatorernorskfamilieokonomi">Norsk Familieøkonomi (kalkulatorer/barometere)</option>
			<option value="googlecalculator3">(Valutakurser (Norges Bank))</option>
			<option value="franklincom">Franklin Electronic Publishers (...electronic language learning solutions...)</option>
			<option value="valutaomregner">Valutaomregner (Currency converter) (Euroinvestor.no)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Diverse markeder - jobb, utleie, møbler, bildeler, biler etc.">
			<option value="finnno">Finn.no (Stilling ledig etc.)</option>
			<option value="zettno">Zett.no (Stilling ledig etc.)</option>
			<option value="ebay">ebay (The World's Online Marketplace)</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			<option value="deltidsjobbno">Deltidsjobb.no (Stilling ledig etc.)</option>
			<option value="salesforcecom">Salesforce.com (Salesforce.com is the market and technology leader in on-demand customer relationship management (CRM))</option>
			<option value="hybelno">Hybel.no (Bolig til leie, møbler og hvitevarer - Alt til hybeltilværelsen)</option>
			<option value="iboligno">iBolig.no (Gratis boligannonser)</option>
			<option value="hybelformidling">Hybelformidling (Hybelformidling - Bergen, Oslo, Trondheim, Sogndal, Volda, Lillestrøm)</option>
			<option value="bilforumetnet">Bilforumet</option>
			<option value="bilinform">Bilinform</option> 
			<option value="bildelerbrukte">Brukte bildeler (Bil-Demontørenes Dataring)</option>
			<option value="finndelno">Finndel.no - Liste over huggerier - Norges største database for brukte bildeler</option> 
			<option value="bildelerbruktenbf">Brukte bildeler (Norges Biloppsamleres Forening (NBF))</option>
			<option value="torshovbilrekvisita">Nye bildeler (Torshov Bilrekvisita)</option>
			<option value="bildelernyebiltema">Nye bildeler (Biltema Norge)</option>
			</optgroup>
		<optgroup label="Skole, studenter, kataloger, rabatter, legater, språk, utdanning etc.">
			<option value="skoleaviser">Skoleaviser (Utdanningsdirektoratet driver denne tjenesten i samarbeid med Avis i skolen)</option>
			<option value="studentaviser">Studentaviser (StudentTorget.no)</option>
			<option value="dreamspark">DreamSpark - Bill Gates talks about Free Software, Students, and Technology</option> 
			<option value="studentkortetno">Studentkortet.no (et fordelskort for alle som studerer på høyskole og universitet i Norge)</option> 
			<option value="facebookcom">Facebook (a social utility that connects you with the people around you)</option>
			<option value="linkedin">LinkedIn (There are 11 million professionals already on LinkedIn)</option>
			<option value="googleliteracyproject">Google Literacy Project (A resource for teachers, literacy organisations and anyone interested in reading and education)</option>
			<option value="studentrabattno">Studentrabatt.no (Rabatter fra ditt studiested: ...)</option>
			<option value="studnetno">Studnet.no (Student's guide to discounts!)</option>
			<option value="studentkatalogenno">Studentkatalogen.no (For studenter som vil spare mye penger!)</option>
			<option value="skoleruta">Skoleruta (skolestart, ferier... - fylkesvis)</option>
			<option value="skolehjelperen">Skolehjelperen (Diverse linker)</option>
			<option value="ansa">ANSA.no (Association of Norwegian Studensts Abroad)</option>
			<option value="googleforeducators">Google for Educators (a teacher's guide to 12 Google products)</option>
			<option value="franklincom">Franklin Electronic Publishers (...electronic language learning solutions...)</option>
			<option value="statenslanekasse">Statens lånekasse for utdanning</option>
			<option value="legathandboken">Søk i Legathåndboken 2006</option>
			<option value="legatsiden">Legatsiden.no (Norske støtteordninger på WEB)</option>
			<option value="studnetno">Studnet.no (student's guide to discounts!)</option>
			<option value="sprak">Språk, språkforståelse og utdanning (mintankesmie.no)</option>
			<option value="skrivekunst">Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap (mintankesmie.no)</option>
			<option value="diversedatatips">Diverse datatips (mintankesmie.no)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			<option value="ideutviklingkreativitet">Idéutvikling, kreativitet og gründervirksomhet (mintankesmie.no)</option>
			<option value="innovasjon">Innovasjon (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Bøker - nettbokhandel">
			<option value="onskebokno">Ønskebok.no en helt ny måte å finne bøker på!</option> 
			<option value="bokkildenno">bokkilden.no</option>
			<option value="norlisnettbokhandel">Norlis nettbokhandel.no</option>
			<option value="haugenbokno">haugenbok.no</option>
			<option value="zoomii">Zoomii (Because I love bookstores)</option>
			<option value="googlebooks">Google Books (Søk i fulltekst og oppdag nye bøker)</option>
			<option value="microsoftbooks">Microsoft eBooks for nedlasting (Engelsk, fransk... ordbok)</option>
			<option value="bookfindercom">BookFinder.com</option>
			<option value="ottobib">OttoBib (Enter ISBN of book(s) - separate with commas (,))</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			</optgroup>
		<optgroup label="Fjernundervisning (nettundervisning)">
			<option value="nkifjernundervisning">NKI Fjernundervisning</option>
			<option value="nksfjernundervisning">NKS fjernundervisning (Studier og kurs)</option>
			<option value="norskforbundforfjernundervisningnff">Norsk forbund for fjernundervisning og fleksibel utdanning (NFF)</option>
			</optgroup>
		<optgroup label="Hjelpemidler for funksjonshemmede">
			<option value="hjelpemidlernav">NAV - Hjelpemidler (Et hjelpemiddel skal bidra til å redusere praktiske problemer)</option>
			<option value="sokhjelpemidler">Søk: "hjelpemidler for funksjonshemmede"</option>
			<option value="rolltalk">ROLLtalk.com - IGEL Kompaniet (Utvikler, produserer og tilrettelegger høyteknologiske hjelpemidler)</option>
			<option value="igeldata">IGEL data - IGEL Kompaniet (NY PROGRAMSNEKKER 6 for PC!)</option>
			<option value="picomed">Picomed er en norsk hjelpemiddelprodusent ("omgivelseskontroll")</option>
			</optgroup>
		<optgroup label="Bøker - nettbokhandel">
			<option value="bokkildenno">bokkilden.no (Norsk)</option>
			<option value="norlisnettbokhandel">Norlis nettbokhandel.no</option>
			<option value="haugenbokno">haugenbok.no</option>
			<option value="zoomii">Zoomii (Because I love bookstores)</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			</optgroup>
		<optgroup label="Offentlige skjemaer">	
			<option value="altinn"> Altinn - Tjenester og skjemaer for privatpersoner ognæring (Altinn brukerservice)</option>
			<option value="kommunaleskjemaer">Diverse kommunale skjemaer (Min side)</option>
			<option value="kontraktsmaler">Kontraktsmaler til fritt bruk (Forbruker.no)</option>
			</optgroup>
		<optgroup label="Min energi - strømsparing">
			<option value="varmepumpe">Forskning.no (Se hvordan varmepumpa virker)</option>
			<option value="minenergi">Min energi (offentlig servicekontor)</option>
			<option value="enova">Enova SF (Enova forvalter Energifondet - støtter ulike typer prosjekter- på gitte kriterier)</option>
			<option value="varmestotte">Varmestøtte opp i røyk (Bare hver femte pelletskamin som fikk statsstøtte i 2003, ble lønnsom)</option>
			<option value="energymaps">Renewable Energy Maps (Interactive map of UK renewable energy locations)</option>
			<option value="energikalkulator">Energiveilederen.no (Energikalkulator - boliger)</option>
			</optgroup>
		<optgroup label="Statistikk">	
			<option value="statistikkbanken">Statistikkbanken (SSB) (lagre dine tabeller for senere bruk)</option>
			<option value="statistikkemne">Statistikker ordnet etter emne - statistikkområder (Statistisk sentralbyrå (SSB))</option>
			<option value="veiviser">Veiviseren fra A til å (Statistisk sentralbyrå (SSB))</option>
			</optgroup>
		<optgroup label="Diverse etater, organer, postjournaler og registre">	
			<option value="offentliginformasjon">Offentlig informasjon på Internett (Kommune/fylke/stat - organer/databaser)</option>				
			<option value="postjournal">Elektronisk postjournal (EPJ) (Informasjon om arbeidssøkertjenester)</option>
			<option value="bronnoysundregistrene">Brønnøysundregistrene (Forvaltningsetat - kontroll- og registreringsordninger...)</option>
			<option value="enhetsregisteret">Nøkkelopplysninger fra Enhetsregisteret (Brønnøysundregistrene)</option>	
			<option value="regelhjelp">Regelhjelp.no (Omfatter nå kravene for 15 bransjer.)</option>				
			<option value="skatteetaten">Skatteetaten (Skatt, moms, arveavgift, arbeidsgiveravgift og folkeregisteret)</option>
			</optgroup>	
		<optgroup label="Juss (lover, lovdata, rettssikkerhet)">
			<option value="lovdatano">Lovdata.no (Lovdata er en privat stiftelse opprettet av Justisdepartementet...)</option>
			<option value="loverlovdata">Lover (Diverse angående lover)</option>				
			<option value="jussportalen">Jussportalen.no (Webportal med en enkel oversikt over de juridiske ressursene)</option>
			<option value="dommereogdomstoler">Dommere og domstoler (mintankesmie.no)</option>					
			<option value="forliksradet">Forliksrådet og forliksklage (mintankesmie.no)</option>	
			<option value="konfliktrådet">Konfliktrådet (mintankesmie.no)</option>
			<option value="riksadvokaten">Riksadvokaten (mintankesmie.no)</option>
			<option value="statsadvokaten">Statsadvokaten (mintankesmie.no)</option>
			<option value="regjeringsadvokaten">Regjeringsadvokaten (mintankesmie.no)</option>
			<option value="statensinnkrevingssentral">Statens Innkrevingssentral (SI) (Frivillig innkreving og Tvangsinnkreving)</option>
			<option value="politianmeldelser">Politiet, politianmeldelser osv. (mintankesmie.no)</option>
			<option value="menneskerettigheter">Menneskerettigheter og menneskerettighetsdomstolen (mintankesmie.no)</option>
			<option value="advokatbladetsomebladher">Les Advokatbladet som eblad/PDF her (jus.no)</option>
			<option value="advokatbladetopplag">Advokatbladet (opplag)</option> 
			<option value="rettpasak">Domstolmagasinet Rett på sak (domstol.no)</option>
			<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option>
			<option value="retstidendeabonnement">Norsk retstidende (Abonnement - Advokatforeningen)</option>
			<option value="retstidende">Norsk retstidende (Tilgjengelig - ABM - Statens senter for arkiv, bibliotek og museum)</option>
			<option value="lovogrettpånett">Lov og rett på nett (Surfing på det juridiske hav)</option>
			</optgroup>
		<optgroup label="Journalistikk">
			<option value="ram">RAM (Rådet for anvendt medieforskning)</option>
			<option value="pressefag">PresseFAG (Et senter for kompetanse)</option>
			<option value="fagpressen">Fagpressen (Foreningen for fagblader i Norge)</option>
			<option value="medieverden">Medieverden (Nyhetsbrev - Senter for Medieøkonomi-Handelshøyskolen BI)</option>
			<option value="instituttjournalistikk">Institutt for Journalistikk (Driver faglig utviklingsarbeid (anvendt forskning)...)</option>
			<option value="bokogsamfunn">Bok og samfunn (Utgitt av Den norske Bokhandlerforening)</option>
			<option value="mediebedrifteneslandsforening">Mediebedriftenes Landsforening (MBL) (Bransje- og utgiverorganisasjon)</option>
			<option value="nppfu">Norsk Presseforbund (NP/PFU) (Medlemsorg. finansierer sekretariat og gen. sekr.)</option>
			<option value="dagensmedier">Dagens Medier (Mediebedriftenes Landsforening)</option>
			<option value="mio">Mediebyråenes Interesseorganisasjon (MIO) (Ivaretar medl. bransjeinteresser)</option>
			<option value="mediestatistikk">Allmenn mediestatistikk (Norske pekere)</option>
			<option value="fair">FAIR (The national media watch group)</option>
			<option value="mediesnakk">Mediesnakk (Diskusjonsforum for deg som jobber i mediebransjen)</option>
			<option value="mediekritikk">Mediekritikk (NRK)</option>
			<option value="journalismnews">Online Journalism News (Mousetrap Media Ltd.)</option>
			</optgroup>
		<optgroup label="Diverse ressurser">
			<option value="detektor">Detektor (Generell emneportal med katalogiserte lenker - Deichmanske bibliotek)</option>
			<option value="elevsonen">Elevsonen (Kunnskap og læring med internett som verktøy)</option>
			<option value="hardefakta">Hardefakta.no (For lettere tilgang til presis informasjon)</option>
			<option value="nsd">Norsk samfunnsvitenskapelig datatjeneste (NSD) (Data(arkiver) - samfunn</option>
			<option value="oppslagsverk">Oppslagsverk på nettet (NLA Lærerhøgskolen - Norsk Lærerakademi)</option>
			</optgroup>
		<optgroup label="Nettsteder - ungdom - hjelp - søkes... (sex, overgrep, spiseforstyrrelser etc.)">
			<option value="ungno">Ung.no (Offentlig informasjon for ungdom)</option>
			<option value="korspaahalsen">Røde Kors-telefonen for barn og ungdom på nett (800 333 21 - Korspaahalsen.no)</option>
			<option value="homofilesungdomstelefon">- Homofiles Ungdomstelefon (HUT) (810 00 277)</option>
			<option value="ungdomsbasen">Ungdomsbasen (Ungdomsbasen - tilbud til deg mellom 13 og 25 år - Trondheim kommune)</option>
			<option value="klaraklok">Klara Klok (Har du spørsmål som er vanskelig å stille?)</option>
			<option value="iksno">Iks.no (Interessegruppa for Kvinner med Spiseforstyrrelser)</option>
			<option value="noabuse">Noabuse.no (Velkommen til webportalen mot overgrep)</option>
			<option value="seksuellopplysning">Klinikk for seksuell opplysning (KSO)</option>
			<option value="unghelseno">Unghelse.no (- Hjelpetilbud til unge)</option>
			<option value="riverside">Riverside (Ungdomsteamet - prosjektet er finansiert av Oslo kommune)</option>
			<option value="stottesentermotincest">Støttesenter mot incest (SMI) (Hjelp til selvhjelp)</option>
			<option value="kirkensos">Kirkens SOS (815 333 00)</option>
			<option value="temapsykiskhelse">Tema: Psykisk helse (Sosial- og helsedirektoratet)</option> 
			<option value="mentalhelsehjelpetelefonen">Mental Helse Hjelpetelefonen (810 300 30)</option>
			</optgroup>
		<optgroup label="Politikk">
			<option value="politiskesaker1">Stortinget (Saker og publikasjoner fra storting og regjering)</option>
			<option value="politiskesaker2">Stortinget (Søk i spørsmål og interpellasjoner - register tilbake til 2.mars 1988)</option>
			<option value="komiteene">Komiteene</option>
			<option value="regjeringen">Stortinget - Regjeringen (Statsminister, statsråder...)</option>
			<option value="stoltenberg">Statsministerens kontor (SMK) - Regjeringen Stoltenberg II</option>
			<option value="partipolitikk">Partipolitikk (Partigruppene på Stortinget)</option>
			</optgroup>
		<optgroup label="Diverse internasjonale linker">
			<option value="essentialinformation">Essential Information</option> 
			<option value="bestofhistorywebsitesbohws">Best of History Web Sites (BOHWS)</option> 
			<option value="toplinks">The Global Citizens for Change</option>
			<option value="wholinks">World Health Organization (WHO) (national, international and intergovernmental organizations)</option>
			<option value="globallinks">Office of Global Health Affairs (OGHA) (U.S. Department of Health and Human Services)</option>
			<option value="propertylinks">International Intellectual Property Links (Canadian Intellectual Property Office - CIPO)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="netthandel"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Netthandel - diverse prisagenter, butikker, bildeler, bøker, kalkulatorer etc.</option>
		<optgroup label="Netthandel - sammenlign priser - rettigheter - klager etc.">
			<option value="prisjaktno" class="addgray">Prisjakt (Norge)</option>
			<option value="prisjaktnu">Prisjakt (Sverige)</option>
			</optgroup>
		<optgroup label="Netthandel - dine rettigheter">
			<option value="netthandelforbrukerradetno">Netthandel - dine rettigheter (forbrukerportalen.no)</option>
			<option value="howarddinshoppingassistent">HOWARD DIN SHOPPING ASSISTENT ("uglen")</option> 
			<option value="forbrukereuropano">Forbruker Europa (Oppstår det uenighet mellom deg og en næringsdrivende i et EU-land eller Island, kan Forbruker Europa bistå)</option> 
			<option value="forbrukereuropanobilimport">Forbruker Europa - Imort av bil</option> 
			<option value="forbrukereuropadk">Forbruger Europa (Dansk tekst)</option> 
			<option value="krevmomsentilbake">Krev momsen tilbake (dinside.no 5.4.2012)</option> 
			<option value="bevispengebruk10ar">Tollvesenet får kreve bevis på din pengebruk i utlandet 10 år tilbake (aftenposten.no 11.5.2012)</option> 
			<option value="globalrefund">Global Refund</option> 
			</optgroup>
		<optgroup label="Valutakurser, toll og avgifter, porto etc.">
			<option value="tollvesenetsauksjoner" class="addgray">Tollvesenets auksjoner - Gi bud på beslaglagte varer (QXL.NO Nettauksjoner)</option> 
			<option value="dealextreme">DealExtreme (Verdens billigste nettbutikk?)</option> 
			<option value="donessastore">Donessa Store - The Original" Login Locker Password Organizer</option> 
			<option value="dingsy">DINGSY</option> 
			<option value="tilbudswebno" class="addgray">tilbudsweb.no (Velg selv hvilken reklame og hvilke tilbud du vil ha!)</option>
			<option value="pricerunnerdk">Pricerunner (Danmark)</option>
			<option value="digipostposten" class="addgray">Digipost - I løpet av våren kan du åpne din digitale postkasse (posten.no/digipost)</option> 
			<option value="ebayinternasjonaltmarked">eBay - Internasjonalt marked</option>
			<option value="batteryclub" class="addgray">batteryClub</option>
			<option value="altitec">Altitec (Batteributikken)</option> 
			<option value="inkclub">inkClub</option>
			<option value="dustclub">dustClub</option> 
			<option value="clasohlsonno">Clas Ohlson (detaljhandelsfirma)</option>
			<option value="endlesscom">endless.com is your destination for contemporary styles, great prices, and fast delivery</option> 
			<option value="finnnoas" class="addgray">Finn.no</option>
			<option value="blocketse">Blocket.se (Sveriges största Köp &amp; Sälj marknad)</option>
			<option value="halvprissverige">Halv pris på svenske bilverksted (dinside.no 20.2.2011)</option> 
			<option value="bileierno">Bileier.no</option> 
			<option value="zettno">Zett.no</option>
			<option value="bestsellersinelectronics" class="addgray">Bestsellers in Electronics &amp; Photo (amazon.co.uk)</option> 
			<option value="cdonnonettbutikk">CDON.no</option>
			<option value="netonnet">NetOnNet</option> 
			<option value="pixmaniacom" class="addgray">PIXmania.com</option>
			<option value="dealno">Deal.no</option> 
			<option value="grouponno">GROUPON</option>
			<option value="microplexno">Microplex.no</option>
			<option value="fireboxcom">Firebox.com</option>
			<option value="minigadgetscom">Minigadgets.com</option> 
			<option value="nyttognyttig">Nytt &amp; Nyttig</option> 
			<option value="prisguideno">Prisguide.no</option>
			<option value="ikea">IKEA</option>
			<option value="elkjopno">Elkjøp</option>
			<option value="dellno">Dell.no</option> 
			<option value="mpxmpx">MPX.no</option> 
			<option value="komplettno">Komplett.no</option> 
			<option value="komplettse">Komplett.se</option> 
			<option value="kelkooprisagent">Kelkoo.no</option>
			<option value="buzzillions">Buzzillions (tester utført av de som har kjøpt produktene</option>
			<option value="selgskiten"> Selg Skiten - Ærlige rubrikkannonser </option> 
			<option value="expertnonethandel">Expert</option> 
			<option value="zarano">ZARA</option> 
			<option value="sokono">Soko.no</option> 
			<option value="solnettbutikker">Sol nettbutikker (alt du trenger på én side)</option>
			</optgroup>
		<optgroup label="Valutakurser, toll og avgifter, porto etc.">
			<option value="digipostposten" class="addgray">Digipost - I løpet av våren kan du åpne din digitale postkasse (posten.no/digipost)</option> 
			<option value="tilbudswebno">tilbudsweb.no (text)</option>
			<option value="googlecalculator3">Valutakurser (Norges Bank)</option>
			<option value="tollogmomskalkulator" class="addgray">Toll- og momskalkulator (dinside.no)</option> 
			<option value="tollogavgiftsdirektoratet">Toll og avgiftsdirektoratet (Netthandel: import av varer kjøpt på Internett)</option>
			<option value="200kronersgrensen" class="addgray">Folk er lei 200-kronersgrensen (dinside.no 26.9.2010)</option> 
			<option value="emomsen2011">Slik blir den nye e-momsen (dinside.no 10.10.2010)</option> 
			<option value="dobbelmoms">Unngå dobbel moms på julegavene (vg.no 25.11.2010)</option> 
			<option value="rive200kronersgrensen" class="addgray">Hun kan rive 200-kronersgrensen</option> 
			<option value="blilurt">Slik unngår du å bli lurt (dinside.no 22.11.2009)</option> 
			<option value="fraktkostnader" class="addgray">Fraktkostnader: Enorme forskjeller (dinside.no 28.1.2010)</option>
			<option value="frimerkerporto">Frimerker - vekt - porto (Bring.no)</option> 
			<option value="hardurett">Har du rett til å åpne pakken? (dinside.no 30.8.2009)</option> 
			<option value="importkalkulatorinternett" class="addgray">Importkalkulator - Skal du handle varer på internett? (toll.no)</option>
			<option value="netthandeltoll">Innførsel: Netthandel (toll.no)</option> 
			<option value="innforselkjoretoy" class="addgray">Kalkulator: innførsel av kjøretøy (toll.no)</option>
			<option value="danskerneitvil">Danskerne er i tvivl om deres forbrugerrettigheder, når de e-handler (forbrug.dk 18.5.2009)</option> 
			<option value="netthandelvanskelig">Gjør netthandel vanskelig (dinside.no 2.5.2009)</option> 
			<option value="unngaradyrnetthandel">Unngå rådyr netthandel (dinside 1.3.2008)</option> 
			</optgroup>
		<optgroup label="Bruktmarkedet, biler, bildeler, loppemarked, fretex.no etc.">
			<option value="rubrikkno">RUBRIKK.NO</option> 
			<option value="tv2torgetno">tv2torget.no</option> 
			<option value="bruktmarkedno">Bruktmarked.no</option>
			<option value="lagersalgno">Lagersalg.no</option> 
			<option value="solvtorgetno">Sølvtorget.no</option>
			<option value="gullvektenno">Gullvekten.no (AURARIUS AS)</option> 
			<option value="lanekontoret">Lånekontoret</option> 
			<option value="markedsplassenno">Markedsplassen.no</option>
			<option value="klikkherno">klikkher.no</option> 
			<option value="qxlno">QXL</option> 
			<option value="iloveikea">I Love Ikea</option> 
			<option value="trueviewdigital">TruView Digital</option> 
			<option value="thinkgeek">ThinkGeek</option> 
			<option value="thingsyouneverknewexisted">Things You Never Knew Existed</option> 
			<option value="loppemarkedinfo">loppemarked.info</option>
			<option value="byttno">bytt.no</option>
			<option value="fretexno">Fretex.no</option>
			<option value="hvaerbilenverdt" class="addgray">Hva er bilen din verdt? (DinSide.no)</option>
			<option value="bilprisersomnyskatteetaten">Bilpriser - listepris som ny (Skatteetaten)</option>
			<option value="bilnorgesbruktbilpriser">BilNorges bruktbilpriser</option> 
			<option value="dinsidebruktbilpriser">DinSide.no bruktbilpriskalkulator</option>
			<option value="bildelerno">Bildeler.no</option> 
			<option value="bildelsbasen">Bildelsbasen - Sveriges största databas med bildelar</option>
			<option value="finndelno">Finndel.no - Liste over huggerier - Norges største database for brukte bildeler</option> 
			<option value="svenskepriserno">SVENSKEPRISER.NO</option> 
			<option value="grenseguiden">Grenseguiden</option> 
			<option value="grensehandel">Grensehandel.info</option> 
			<option value="svenskeporten">Svenskeporten</option> 
			<option value="biltorgetse">Biltorget.se</option> 
			<option value="mobilede" class="addgray">Mobile24.no (Mobile.de) - Bruktbilpriser - Import</option> 
			<option value="mobilededeutchland">Mobile.de</option> 
			<option value="forbrukereuropano">Forbruker Europa (skal hjelpe forbrukere og næringsdrivende - effektiv løsning på konflikter i alle EU-land og Island)</option> 
			<option value="enklereabruktimportere">Enklere å bruktimportere, men styr unna fellene (dagbladet.no 24.1.2012)</option> 
			<option value="importeredrommebilen">Nå blir det enklere å importere drømmebilen (dagbladet.no 4.8.2011)</option>
			<option value="importerebilenselv" class="addgray">Spar opptil 100.000 på å importere bilen selv (nrk.no 30.9.2011)</option> 
			<option value="bildelerbrukte">Brukte bildeler (Bil-Demontørenes Dataring)</option>
			<option value="bildelerbruktenbf" class="addgray">Brukte bildeler (Norges Biloppsamleres Forening (NBF))</option>
			<option value="torshovbilrekvisita">Nye bildeler (Torshov Bilrekvisita)</option>
			<option value="bildelernyebiltema">Nye bildeler (Biltema Norge)</option>
			</optgroup>
		<optgroup label="Utleie, kjøp, salg etc.">
			<option value="finnnoeiendom">Finn.no/eiendom</option>
			<option value="zettnoeiendom">Zett.no/eiendom</option> 
			<option value="tindeno">Tinde.no</option> 
			<option value="nyno">Ny.no</option> 
			<option value="boligano">Boliga.no (informasjon om hvor lenge boligene har vært til salgs, og om de er satt ned eller opp i pris innen denne perioden)</option> 
			<option value="boligadk">Boliga.dk</option>
			<option value="utleiemeglerenno">Utleiemegleren.no</option> 
			<option value="hybelno">Hybel.no</option> 
			<option value="hvaerbilenverdt">Hva er bilen din verdt? (DinSide.no)</option> 
			<option value="papirloftet">Papirloftet</option> 
			<option value="razorpit">Razorpit</option> 
			<option value="zoombitscouk">zoombits.co.uk</option> 
			<option value="shirtsmyway">ShirtsMyWay (Design your dress shirt) (design din skjorte, levert på døra)</option> 
			<option value="pinkbubbles">Pinkbubbles (morsom nettbutikk med fantastiske badeprodukter)</option>
			<option value="nettflisno">Nettflis.no (stort vareutvalg fra ledende Norske, Italienske og Spanske produsenter)</option>
			<option value="storogfinno">StorOgFin.no (for store og fine damer)</option> 
			<option value="bleiebodenno">Bleieboden (norsk distributør for alle BumGenius produkter)</option> 
			<option value="elefunwebshop">Elefun webshop</option> 
			<option value="igroshage">I Gros Hage</option> 
			<option value="konkurssalgetno">KonkursSalget.no</option> 
			<option value="kenmarwatches">KenmarWatches</option> 
			<option value="bestbuycom">BestBuy</option>
			<option value="hammachercom">Hammacher.com</option> 
			<option value="netthandelennorgeas">Netthandelen Norge AS</option> 
			<option value="fessno">Fess.no - fordi ingen kvinner er like!</option>
			<option value="netshopno">Netshop.no (hentelager i Sandefjord og Oslo)</option>
			<option value="tjenestetorgetno">Tjenestetorget.no (tilbud fra flere leverandører)</option>
			<option value="collectstore">Collect@store</option> 
			<option value="lefdalcom">Lefdal</option>
			<option value="direktronikno">Direktronik</option> 
			<option value="googlestore">Google Store (You've found the right place for all things Googley)</option>
			<option value="elkjopfotofremkalling">Elkjøp Fotofremkalling (Nordens største handelsforetak innen forbrukerelektronikk)</option>
			<option value="lefdalcomfotofremkalling">Lefdal Digitale fargebilder (Bildene kan sendes til din private adresse eller hentes hos Lefdal)</option>
			<option value="treffno">Gratis Rubrikkannonser på Treff.no</option>
			<option value="henneno">Her gjør du gode nettkjøp (henne.no)</option> 
			<option value="telepriserno">telepriser.no (sammenlign priser for fasttelefon, mobiltelefoni og Internett)</option>
			<option value="tollogavgiftsdirektoratet">Toll og avgiftsdirektoratet</option>
			<option value="hardwareno">Hardware.no</option>
			<option value="idgnopcworld">IDG.no (Pcworld etc.)</option>
			<option value="lydogbilde">Lyd &amp; Bilde (nettbutikk etc.)</option>
			<option value="taylorshoes">Taylor Shoes</option> 
			<option value="backcountrycom">Backcountry.com (Sportsutstyr)</option>
			<option value="tramdockcom">TRAMDOCK.com</option> 
			<option value="mountaingearcom">Mountain Gear</option> 
			<option value="bandhphotovideo">B&amp;H Photo Video (Shop Digital Cameras, 35MM Camera Equipment etc.)</option> 
			<option value="steam">Steam (Valve Corporation)</option>
			<option value="visanorge">Visa Norge</option> 
			<option value="teller">Teller</option> 
			<option value="nettbutikkervisa">Findeasy Nettkatalogen (nettbutikker og tjenester fra skandinavia)</option>
			</optgroup>
		<optgroup label="Design etc.">
			<option value="lookfantasticcom">lookfantastic.com</option> 
			<option value="strawberrynetcom">StrawberryNET.com</option>
			<option value="eluxurycom">eLUXURY.com</option> 
			<option value="thelifeofluxury">The Life of Luxury</option> 
			<option value="saksfifthavenuecom">SAKS FIFTH AVENUE</option>
			<option value="mulberrycom">Mulberry.com</option> 
			<option value="jimmychoocom">Jimmy Choo</option>
			<option value="burberrycom">Burberry.com</option> 
			<option value="marnicom">Marni</option>
			<option value="tiffanycom">Tiffany &amp; Co.</option> 
			</optgroup>
		<optgroup label="Tid, reiser, GPS, UDs landsider, skikk og bruk etc.">
			<option value="verdensuret">Verdensuret (Time and Date AS)</option>
			<option value="restplassno">restplass.no (Registrer deg gratis i Norges største reiseklubb for gode reisetilbud)</option>
			<option value="reiseklinikken">Reiseklinikken.no (Reisemedisin er ikke bare vaksinering)</option> 
			<option value="momondo">Momondo (Helps you find cheap flights instantly)</option>
			<option value="orbville">Orbville.no</option> 
			<option value="kayak">Kayak</option> 
			<option value="verdensbesteflyselskaper">Verdens beste flyselskaper (Forbes)</option>
			<option value="verdensbilligsteflyselskaper">Verdens beste billig-flyselskaper (Forbes)</option>
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			<option value="timeleft">TimeLeft (a free clock, reminder, alarm clock, tray clock, countdown clock, stopwatch, timer...)</option>
			<option value="flybussekspressenas">Flybussekspressen AS (til/fra flyplassen)</option>
			<option value="sasbraathens">SAS Braathens (Planlegg og bestill flyreise)</option>
			<option value="norwegian">Norwegian Air Shuttle (Lavpriskalenderen)</option>
			<option value="kelkoo">kelkoo (Flybilletter)</option>
			<option value="dinsidereise">DinSide Reise</option>
			<option value="reisefeber">Reisefeber.no</option>
			<option value="nordnorgesguidenno">Nordnorgesguiden.no</option> 
			<option value="boocom">Boo.com (a new type of travel website that will help change the way you search for travel online)</option>
			<option value="flybilligstcom">flybilligst.com (et verktøy som hjelper deg å finne de billigste flybillettene)</option>
			<option value="solfaktoras">SOLFAKTOR AS - søk blant feriereiser og restplasser fra samtlige nordiske charteroperatører og utvalgte lavpris flyselskap</option>
			<option value="skyeuropeairlines">SkyEurope Airlines (The Gateway to Central Europe!)</option>
			<option value="ebookersno">ebookersno (Europas største reisebyrå på Internett)</option>
			<option value="sidestep">SideStep (Find the best bargains from multiple travel sites)</option>
			<option value="globalhotelindex">Global Hotelindex (Integrates Google-Maps for user friendliness)</option>
			<option value="tomtom">TomTom (a leading provider of personal navigation products and services)</option>
			<option value="garmin">Garmin (en av verdens største produsenter av GPS-produkter)</option>
			<option value="wayfindercom">Wayfinder.com (Kart-, vägvisnings- och GPS-navigeringstjänster för mobiltelefoner)</option>
			<option value="reisevaksinerhvilketrengs1">Reisevaksiner – hvilke trengs? (Tidsskriftet)</option>
			<option value="reisevaksinerhvilketrengs2">Vet du om du trenger vaksiner før neste ferietur? (Aftenposten.no)</option>
			<option value="dinsidesvaksinekalkulator">Hvilke vaksiner trenger du? (DinSides vaksinekalkulator)</option>
			<option value="reisevaksinerfor2000kroner">2000 kroner for ferievaksiner (Aftenposten.no)</option>
			</optgroup>
		<optgroup label="Forbrukerhjelp - diverse tester etc.">
			<option value="alatest">alaTEST (forbrukerhjelp - finn de beste mobiltelefoner etc.)</option>
			<option value="wizecom">Wize.com (offers a better way to do consumer research)</option>
			<option value="teknofilno">teknofil.no (A-Pressen ASA)</option>
			</optgroup>
		<optgroup label="Diverse markeder - jobb, utleie, møbler, bildeler, biler, kalkulatoreretc.">
			<option value="finnno">Finn.no (Stilling ledig etc.)</option>
			<option value="zettno">Zett.no (Stilling ledig etc.)</option>
			<option value="stepstone">StepStone ("Vi skal være best på jobb og karriere - ikke alt annet...")</option>
			<option value="eurojobscom">Eurojobs.com (FREE pan-European job portal)</option>
			<option value="jobsnet">Jobs.net (USA)</option>
			<option value="ebay">ebay (The World's Online Marketplace)</option>
			<option value="ebayexpress">eBay Express (The World's Online Marketplace)</option>
			<option value="pricerunner">Pricerunner (tester)</option>
			<option value="prisjakt">Prisjakt</option>
			<option value="like">Like (Likeness Search finds similar styles to those shown)</option>
			<option value="googlefroggleagent">Google Froggle</option>
			<option value="deltidsjobbno">Deltidsjobb.no (Stilling ledig etc.)</option>
			<option value="salesforcecom">Salesforce.com (Salesforce.com is the market and technology leader in on-demand customer relationship management (CRM))</option>
			<option value="hybelno">Hybel.no (Bolig til leie, møbler og hvitevarer - Alt til hybeltilværelsen)</option>
			<option value="iboligno">iBolig.no (Gratis boligannonser)</option>
			<option value="hybelformidling">Hybelformidling (Hybelformidling - Bergen, Oslo, Trondheim, Sogndal, Volda, Lillestrøm)</option>
			<option value="bilforumetnet">Bilforumet</option>
			<option value="bilinformno">Bilinform.no - Spør vår bilmekaniker</option>
			</optgroup>
		<optgroup label="Bøker - nettbokhandel">
			<option value="bokkildenno">bokkilden.no</option>
			<option value="norlisnettbokhandel">Norlis nettbokhandel.no</option>
			<option value="haugenbokno">haugenbok.no</option>
			<option value="zoomii">Zoomii (Because I love bookstores)</option>
			<option value="googlebooks">Google Books (Søk i fulltekst og oppdag nye bøker)</option>
			<option value="microsoftbooks">Microsoft eBooks for nedlasting (Engelsk, fransk... ordbok)</option>
			<option value="bookfindercom">BookFinder.com</option>
			<option value="ottobib">OttoBib (Enter ISBN of book(s) - separate with commas (,))</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			</optgroup>
		<optgroup label="Diverse kalkulatorer - ringepriser utland, abonnement, valutakurser">
			<option value="mobilkalkulatoren">Mobilkalkulatoren (Sammenlignbare teleoperatørpriser)</option>
			<option value="mobiliutlandet">Mobil i utlandet (Kalkulator - hva koster å bruke mobiltelefon i utvalgte land)</option>
			<option value="googlecalculator3">Valutakurser (Norges Bank)</option>
			<option value="valutaomregner">Valutaomregner (Currency converter) (Euroinvestor.no)</option>
			<option value="norskkalkulator">Kalkulator (Matte.no)</option>
			<option value="allealkulatorer">Alle kalkulatorene (DinSide)</option>
			</optgroup>
		<optgroup label="Posten, postnummer, landkoder, pakkesporing, opplysning etc.)">
			<option value="postenn">Søk postnummer og poststedsnavn i Norge (Posten)</option>
			<option value="postendk">Danmark, Færøerne og Grønland (Post Danmark A/S)</option>
			<option value="postens">Sverige (Posten)</option>
			<option value="pakkesporingwebfokus">Pakkesporing (Webfokus)</option>
			<option value="retningsnummerutland">Landkoder (Slik ringer du til utlandet - tast 00 + landkode + retningsnummer + nummer du vil ringe)</option>
			<option value="teldirdialingcodes">Teldir (International dialing Codes - anywhere in the world)</option>
			<option value="opplysning1890">Opplysning 1890 hjelper deg med navn, numre og adresser (EasyConnect AS)</option>
			<option value="opplysningen1881">Opplysningen 1881 (Opplysningen AS)</option>				
			<option value="proff">Proff - bedrifter og privatpersoner (Findexa Proff Telefonkatalogen Gule Sider)</option>		
			<option value="anywho">AnyWho (FIND A PERSON - FIND A BUSINESS)</option>		
			<option value="teldir">Teldir (Find anyone anywhere in the world)</option>
			<option value="searchsystemsnet">Searchsystems.net (Now over 38,097 Searchable Public Record Databases!)</option>
			</optgroup>
		<optgroup label="Diverse artikler">
			<option value="tollkontrollpraksis">Krever endring i kontroll-praksis - Datatilsynet vil at Tollvesenet endrer sin kontroll-praksis av privatpersoners utenlandskjøp (dinside.no 6.11.2011)</option> 
			<option value="betalefraktkostnadene">Du skal ikke betale fraktkostnadene (dinside.no 16.8.2011)</option> 
			<option value="usikkerpanettbutikken">Usikker på nettbutikken? (forbruker.no 26.11.2007)</option> 
			<option value="billigerepanett">Kjøp gavene billigere på nettet (forbruker.no 21.11.2007)</option> 
			<option value="prisenlikegyldig">- Prisen er likegyldig (forbruker.no 10.9.2007)</option> 
			<option value="norskenettbutikkerkanvareutenlandske">«Norske» nettbutikker kan være utenlandske - Kan skape store problemer... (forbruker.no 10.10.2007)</option> 
			<option value="ikkesabilligsomdutror">Ikke så billig som du tror (dn.no 18.11.2007)</option> 
			<option value="nettverstingene">Her er nettverstingene (forbruker.no)</option>
			<option value="shoppersegsyke">Shopper seg syke (dn.no 18.11.2007)</option> 
			<option value="netthandlerettigheter">Netthandel – dine rettigheter (bokmål) (forbrukerportalen.no)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="underholdning"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Underholdning - reiser, sport, spill, musikk, video, film, festivaler, skole etc.</option>
		<optgroup label="Musikk">
			<option value="spotify">Spotify</option>
			<option value="rdio">Rdio</option> 
			<option value="theechonestcom">Echonest (Simply open Spotify and enter an artist in the box below to hear a radio station that you'll love)</option> 
			<option value="wimp">Wimp</option>
			<option value="musicunlimited">Music Unlimited</option> 
			<option value="spillelistenno">spillelisten.no</option> 
			<option value="platekompaniet">Platekompaniet</option>
			<option value="dizzlercom">Dizzler.com</option>
			<option value="deezer">Deezer</option> 
			<option value="jango">Jango</option>
			<option value="grooveshark">Grooveshark (gratis musikk-jukeboks-tjeneste)</option> 
			<option value="rhapsody">Rhapsody</option> 
			<option value="pulptunescom">pulpTunes.com</option> 
			<option value="myspacemusic">MySpace Music</option>
			<option value="songza">Songza (Songza lets you listen to any song or band. Search for it:)</option>
			<option value="lastfmradio">Last.fm radio (Start Listening with Last.fm)</option>
			<option value="orborb">Orb</option> 
			<option value="allmusic">Allmusic</option>
			<option value="amplifiedjourneys">Amplified Journeys (music to match your journey)</option> 
			<option value="musikkarkivetno">Musikkarkivet.no (NRK har samlet på musikk siden 1933 - «du har minnene, vi har musikken»)</option> 
			<option value="freemusicdownloadsamazon">Amazon.com (Free Music Downloads)</option>	
			<option value="playcom">Play.com</option> 
			<option value="cdommp3">CDON.COM (e-handelsplass på Internet)</option> 
			<option value="topp10album">CDON.COM - Norges offisielle toppliste - topp 10 album</option> 
			<option value="musikkonline">musikkonline.no (nettets største samling av norsk musikk!)</option> 
			<option value="we7">We7 (Deliver free, legal and safe music, video and other digital entertainment to everyone who wants to download it)</option> 	
			<option value="imeemcom">imeem.com (imeem is an online community where millons of fans and artists discover new music, videos, and photos, and share their tastes with friends)</option> 
			<option value="meemix">MeeMix (Imagine a world of music - sorted by the songs you love)</option>
			<option value="joggingmusic">Jogging Music</option> 
			<option value="jogtunescom">JogTunes (Music at your speed)</option>
			<option value="audiofuel">AudioFuel</option> 
			<option value="mp3running">MP3Running</option> 
			<option value="konsertsonen">Konsertsonen</option> 
			<option value="legacyrecordings">Legacy Recordings (Grammy Award-winning division at Sony BMG Music Entertainment)</option> 
			<option value="freemusiczillacom">Freemusiczilla.com (Download Free Music from Social Music Service)</option> 
			<option value="spiralfrog">SpiralFrog (...a market-driven solution to illicit pirate file-sharing sites)</option> 
			<option value="norsktunerdigitalradio">Norsk Tuner Digitalradio (gratis, med reklame)</option>
			<option value="radioparadise">Radio Paradise (listener-supported)</option>
			<option value="screamerradio">Screamer Radio (a freeware Internet Radio player for Microsoft Windows)</option>
			<option value="intersoundusbinternettradio">Intersound USB Internett radio (mer enn 13 000 radiokanaler programmert i denne lille usb-brikken)</option> 
			<option value="raimaradio">RaimaRadio (allows you to listen to and record radio stations from around the world)</option>
			<option value="pandoracom">Pandora.com (The Music Genome Project - kun for bosatte i USA)</option>
			<option value="googledirectoryartsmusicbandsandartists">Google Directory - Arts - Music - Bands and Artists</option>
			<option value="splice">Splice (Users can upload or record sounds, make songs, listen to other user's songs, make remixes, make friends and a whole lot more)</option>
			<option value="nrkurort">NRK Urørt (Gratis nedlasting av musikk)</option>
			<option value="nrkurortsamleside">NRK Urørt (Samleside)</option>
			<option value="shoutcastradio">SHOUTcast Radio (free Internet Radio)</option>		
			<option value="sideload">SIDELOAD (Free tracks from from 21,219 Artists - MP3)</option>			
			<option value="downloadcommusic">Download.com Music (The premier source for free music - MP3)</option>			
			<option value="smsmp3">SmsMp3 (Låter som kan lastes ned gratis)</option>
			<option value="musikkdownload">Sol.no (musikkdownload)</option>
			<option value="artistservercom">ArtistServer.com - Free music, mp3 downloads, blogs, and more - join the community</option>
			<option value="mtvfreemusicdownloads">MTV (Free Music Downloads)</option>
			<option value="kvasirslydogbildesok">Kvasirs (lyd- og bildesøk / nedlasting av musikk)</option>
			<option value="windowsmediacommusic">WindowsMedia.com (Music)</option>
			<option value="googledirectoryarts">Google Directory - Arts</option>
			<option value="googledirectoryartsradio">Google Directory - Arts - Radio</option>
			<option value="googledirectoryartsmusic">Google Directory - Arts - Music</option>
			<option value="yahoolyrics">Yahoo! Lyrics (gratis tilgang til hundretusener av sangtekster)</option>
			<option value="guitarcordfinder">Guitar Chord Finder (Guitar chord dictionary - 100's of chords)</option>
			</optgroup>
		<optgroup label="Bilder (photos)">
			<option value="flicrphotosharing">Flickr (- almost certainly the best online photo management and sharing application in the world)</option>
			</optgroup>
		<optgroup label="Videoer etc.">
			<option value="veohcom">Veoh.com (videotjeneste - NBC og Paramount)</option>
			<option value="youtube">YouTube.com (YouTube is a consumer media company for people to watch and share original videos...)</option>
			<option value="disneycom">Disney.com</option> 
			<option value="myspacecom">Myspace.com (MySpace is an online community that lets you meet your friends' friends)</option>
			<option value="facebookcom">Facebook (a social utility that connects you with the people around you)</option>
			<option value="yahoomusicvideos">Yahoo! Music Videos</option>
			</optgroup>
		<optgroup label="Film, kino etc.">
			<option value="filmwebno">FILWEB.no (Filmweb AS)</option>
			<option value="youtubemovies">YouTube Movies - More than 3,000 full-length feature films from major Hollywood studios</option> 
			<option value="appletrailer">Apple Trailers</option> 
			<option value="voddlercom">Voddler.com</option> 
			<option value="headweb">Headweb</option> 
			<option value="onlinefilmskole">Online filmskole: Optimal filmopplevelse (online.no)</option> 
			<option value="alltime100bestmovies">ALL-TIME 100 best movies (Time)</option> 
			<option value="top250movies">Top 250 movies as voted by our users (An amazon.com conpany)</option>
			<option value="metacriticcom">Metacritic.com - All Time HighScores (CNET Networks, Inc.)</option>
			<option value="filmarkivetno">Filmarkivet.no (NorgesFilm AS og Norsk Filminstitutt)</option>
			<option value="imdb">The Internet Movie Database (IMdb)</option>
			<option value="coollector">Coollector movie database (free)</option>
			<option value="metacritic">Metacritic (Omtaler av film, video, musikk, spill, bøker og fjernsyn)</option>
			<option value="film101com">Film101.com (films that have been strongly recommended by critics and filmmakers...)</option>
			<option value="meeveeinternettv">MeeVee (Explore the world of Internet TV by browsing popular channels or even by country</option>	
			</optgroup>
		<optgroup label="TV over Internett (programmer)">
			<option value="slingbox">SlingBox (allows you to watch live television via the Internet on your computer or mobile phone)</option> 
			<option value="craftytvcom">CraftyTV.com</option>
			<option value="tomainternettv">TOMA - Internet TV (The biggest and best database of online TV channels in the whole world)</option> 
			<option value="tvcomtvcom">TV.com</option> 
			<option value="joost">Joost</option>
			<option value="miro11watchvideoyoutube">Miro 1.2 - Turn your computer into an internet TV - watch free internet video channels and play any video file</option> 
			<option value="vdownloader">VDownloader (can download and convert videos from Youtube... and many other similar sites... saving them in AVI or MPG format)</option> 
			<option value="tvexecom">TVexe.com (Watch 300+ live worldwide TV channels, on your PC free)</option> 	
			<option value="zattoolivetv">Zattoo is live TV on your PC</option> 
			<option value="knockatv">Knocka.TV</option> 
			<option value="allekategorierdagbladetno">TV-program - Alle kategorier (Dagbladet.no)</option>
			<option value="sopcastcom">SopCast.com ("Internet Broadcasting" på PC)</option>		
			<option value="tvsquad">tvsquad (Where to find your favorite shows online)</option>		
			<option value="jclsinternettv">JLC's Internet TV (automatically finds over 1400 channels)</option>
			<option value="wwitv">WWITV: World Wide Internet TeleVision (Se andre lands TV-programmer gratis på nett)</option>
			<option value="brightcovecom">Brightcove.com (Brightcove is an Internet TV service)</option>
			<option value="oldcartoontvcom">OldCartoonsTV.com</option>
			</optgroup>
		<optgroup label="Sosiale nettsamfunn">
			<option value="facebookcom">Facebook (a social utility that connects you with the people around you)</option>
			<option value="bebocom">Bebo (the next generation social networking service...)</option> 
			<option value="myspacenorge">MySpace Norge</option> 
			<option value="linkedin">LinkedIn (There are 11 million professionals already on LinkedIn)</option>
			<option value="googleorkut">Google orkut</option> 
			<option value="friendster">Friendster</option>
			<option value="ning">Ning</option> 
			</optgroup>
		<optgroup label="Biografier">
			<option value="biographycom">Biography.com - Search for anyone (A&amp;E Television Networks)</option>					
			<option value="fansites">FanSites (Hollywood Media Corp. (NASDAQ: HOLL))</option>
			</optgroup>
		<optgroup label="Spill etc.">
			<option value="gamespotcom">GameSpot.com</option>
			<option value="theeescapist">the escapist</option> 
			<option value="gamerankings">Gamerankings</option> 
			<option value="eurogamer">Eurogamer</option> 
			<option value="ignign">IGN</option> 
			<option value="nettavisennettspilltv2">Nettavisen: Nettspill (TV 2)</option>
			<option value="itavisenspilltest">ITAVISEN SPILL (Spilltest)</option>
			<option value="steam">Steam (Valve Corporation)</option> 
			<option value="tokyogameshow">TOKYO GAME SHOW (Computer Entertainment Supplier's Association Nikkei Business Publications, Inc.)</option>
			<option value="yahooligans">Yahooligans! (The WEb Guide for Kids)</option>
			</optgroup>
		<optgroup label="Konserter, festivaler etc.">
			<option value="festivalmusikkunderholdning">Sol.no (Underholdning, musikk, festival...)</option>
			<option value="konsertsonen">Konsertsonen</option> 
			</optgroup>
		<optgroup label="Diverse nettsteder">
			<option value="webmarketingassociation">The Web Marketing Association (WebAwards)</option> 
			<option value="biggsgilmore">Biggs|Gilmore</option> 
			<option value="ablegrape">Able Grape (Vin-søkemotor)</option> 
			<option value="coolhomepagescom">CoolHomepages.com</option>
			<option value="50bestwebsites2012">50 Best Websites 2012 (time.com)</option>
			<option value="internetadvertisingcompetitionawards">the Internet Advertising Competition Awards (The Web Marketing Association)</option> 
			</optgroup>
		<optgroup label="Cruise">
			<option value="norwegianccruiseline">Norwegian Cruise Line</option>
			<option value="royalcaribbeancruiseline">Royal Caribbean Cruise Line</option>
			<option value="princesscruises">Princess Cruises</option>
			</optgroup>
		<optgroup label="Tid, reiser, GPS, UDs landsider, skikk og bruk etc.">
			<option value="verdensuret">Verdensuret (Time and Date AS)</option>
			<option value="reiseklinikken">Reiseklinikken.no (Reisemedisin er ikke bare vaksinering)</option> 
			<option value="googlecitytours">Google City Tours</option> 
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			<option value="timeleft">TimeLeft (a free clock, reminder, alarm clock, tray clock, countdown clock, stopwatch, timer...)</option>
			<option value="flybussekspressenas">Flybussekspressen AS (til/fra flyplassen)</option>
			<option value="sasbraathens">SAS Braathens (Planlegg og bestill flyreise)</option>
			<option value="norwegian">Norwegian Air Shuttle (Lavpriskalenderen)</option>
			<option value="visitnorwaycom">Visitnorway.com (Innovation Norway)</option> 
			<option value="kelkoo">kelkoo (Flybilletter)</option>
			<option value="restplassno">restplass.no (Registrer deg gratis i Norges største reiseklubb for gode reisetilbud)</option>
			<option value="flybilligstcom">flybilligst.com (et verktøy som hjelper deg å finne de billigste flybillettene)</option>
			<option value="solfaktoras">SOLFAKTOR AS - søk blant feriereiser og restplasser fra samtlige nordiske charteroperatører og utvalgte lavpris flyselskap</option>
			<option value="skyeuropeairlines">SkyEurope Airlines (The Gateway to Central Europe!)</option>
			<option value="ebookersno">ebookersno (Europas største reisebyrå på Internett)</option>
			<option value="sidestep">SideStep (Find the best bargains from multiple travel sites)</option>
			<option value="expedianorway">Expedia Norway (Expedia Inc)</option> 
			<option value="organizeyourowntrip">Organize your Own Trip (This blog is about travelling and gives you useful information to make your own trip)</option> 
			<option value="globalhotelindex">Global Hotelindex (Integrates Google-Maps for user friendliness)</option>
			<option value="tomtom">TomTom (a leading provider of personal navigation products and services)</option>
			<option value="garmin">Garmin (en av verdens største produsenter av GPS-produkter)</option>
			<option value="wayfindercom">Wayfinder.com (Kart-, vägvisnings- och GPS-navigeringstjänster för mobiltelefoner)</option>
			<option value="reisevaksinerhvilketrengs">Reisevaksiner hvilke trengs?</option>
			<option value="dinsidesvaksinekalkulator">Hvilke vaksiner trenger du? (DinSides vaksinekalkulator)</option>
			<option value="forbesmostdangerousdestinations">Forbes Most Dangerous Destinations 2007</option>
			<option value="googleearth">Google Earth - A 3D interface to the planet (Program for nedlasting)</option>		
			<option value="modisimages">MODIS (or Moderate Resolution Imaging Spectroradiometer)</option>
			<option value="elkjopfotofremkalling">Elkjøp Fotofremkalling (Nordens største handelsforetak innen forbrukerelektronikk)</option>
			<option value="lefdalcomfotofremkalling">Lefdal Digitale fargebilder (Bildene kan sendes til din private adresse eller hentes hos Lefdal)</option>
			<option value="udslandsider">UDs landsider (Utenriksdepartementet)</option>
			<option value="skikkogbrukno">Skikkogbruk.no (Kunnskapsdatabase - de skrevne/uskrevne sosiale regler...)</option>
			<option value="farvelfolkeskikk">Farvel, folkeskikk (dinside.no)</option>
			<option value="kartbutikkenno">kartbutikken.no (GPS, kart etc. - UGLAND IT GROUP AS)</option>
			<option value="gpsno">GPS.no (Nettsted for satellittbasert navigasjon) - The Global Positioning System (GPS)</option>
			<option value="gpstest">GPS test (Dingz.no)</option>
			<option value="gpspakke">GPS pakke for navigering i Skandinavia (Wayfinder Navigator)</option>
			<option value="stephenpmorse">Stephen P. Morse (Converting Addresses to Latitude/Longitude in One Step)</option>
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			</optgroup>
		<optgroup label="Mat og drikke...">
			<option value="matprat">matPrat (Opplysningskontoret for kjøtt arbeider med merkenøytral informasjon)</option>
			<option value="aperitifno">Aperitif.no (Nordens største nettsted om mat og drikke)</option>
			<option value="artoftaste">Art of Taste (Hjemmet Mortensens nettsatsing på mat og drikke)</option>
			</optgroup>
		<optgroup label="Diverse markeder - jobb, utleie, møbler, bildeler, biler etc.">
			<option value="finnno">Finn.no (Stilling ledig etc.)</option>
			<option value="zettno">Zett.no (Stilling ledig etc.)</option>
			<option value="ebay">ebay (The World's Online Marketplace)</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			<option value="deltidsjobbno">Deltidsjobb.no (Stilling ledig etc.)</option>
			<option value="salesforcecom">Salesforce.com (Salesforce.com is the market and technology leader in on-demand customer relationship management (CRM))</option>
			<option value="hybelno">Hybel.no (Bolig til leie, møbler og hvitevarer - Alt til hybeltilværelsen)</option>
			<option value="iboligno">iBolig.no (Gratis boligannonser)</option>
			<option value="hybelformidling">Hybelformidling (Hybelformidling - Bergen, Oslo, Trondheim, Sogndal, Volda, Lillestrøm)</option>
			<option value="bilforumetnet">Bilforumet</option>
			<option value="bildelerbrukte">Brukte bildeler (Bil-Demontørenes Dataring)</option>
			<option value="bildelerbruktenbf">Brukte bildeler (Norges Biloppsamleres Forening (NBF))</option>
			<option value="torshovbilrekvisita">Nye bildeler (Torshov Bilrekvisita)</option>
			<option value="bildelernyebiltema">Nye bildeler (Biltema Norge)</option>
			<option value="dingzno">Dingz.no (Aller Internett)</option>
			</optgroup>
		<optgroup label="Fjernundervisning (nettundervisning)">
			<option value="nkifjernundervisning">NKI Fjernundervisning</option>
			<option value="nksfjernundervisning">NKS fjernundervisning (Studier og kurs)</option>
			<option value="norskforbundforfjernundervisningnff">Norsk forbund for fjernundervisning og fleksibel utdanning (NFF)</option>
			</optgroup>
		<optgroup label="Skole, studenter, kataloger, rabatter, legater, språk, utdanning etc.">
			<option value="skoleaviser">Skoleaviser (Utdanningsdirektoratet driver denne tjenesten i samarbeid med Avis i skolen)</option>
			<option value="studentaviser">Studentaviser (StudentTorget.no)</option>
			<option value="facebookcom">Facebook (a social utility that connects you with the people around you)</option>
			<option value="linkedin">LinkedIn (There are 11 million professionals already on LinkedIn)</option>
			<option value="googleliteracyproject">Google Literacy Project (A resource for teachers, literacy organisations and anyone interested in reading and education)</option>
			<option value="studentrabattno">Studentrabatt.no (Rabatter fra ditt studiested: ...)</option>
			<option value="studnetno">Studnet.no (Student's guide to discounts!)</option>
			<option value="studentkatalogenno">Studentkatalogen.no (For studenter som vil spare mye penger!)</option>
			<option value="studicious">stu.dicio.us (10 Reasons Students Need Studicious)</option>
			<option value="skoleruta">Skoleruta (skolestart, ferier... - fylkesvis)</option>
			<option value="skolehjelperen">Skolehjelperen (Diverse linker)</option>
			<option value="ansa">ANSA.no (Association of Norwegian Studensts Abroad)</option>
			<option value="googleforeducators">Google for Educators (a teacher's guide to 12 Google products)</option>
			<option value="franklincom">Franklin Electronic Publishers (...electronic language learning solutions...)</option>
			<option value="statenslanekasse">Statens lånekasse for utdanning</option>
			<option value="legathandboken">Søk i Legathåndboken 2006</option>
			<option value="legatsiden">Legatsiden.no (Norske støtteordninger på WEB)</option>
			<option value="studnetno">Studnet.no (student's guide to discounts!)</option>
			<option value="rolltalk">ROLLtalk.com - IGEL Kompaniet (Utvikler, produserer og tilrettelegger høyteknologiske hjelpemidler)</option>
			<option value="sprak">Språk, språkforståelse og utdanning (mintankesmie.no)</option>
			<option value="skrivekunst">Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap (mintankesmie.no)</option>
			<option value="diversedatatips">Diverse datatips (mintankesmie.no)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			<option value="ideutviklingkreativitet">Idéutvikling, kreativitet og gründervirksomhet (mintankesmie.no)</option>
			<option value="innovasjon">Innovasjon (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Bøker - nettbokhandel">
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			<option value="theuniversaldigitalllibrary">The Universal Digital Library (Enter any word in the book title. e.g. Operas)</option> 
			<option value="bokkildenno">bokkilden.no</option>
			<option value="norlisnettbokhandel">Norlis nettbokhandel.no</option>
			<option value="haugenbokno">haugenbok.no</option>
			<option value="zoomii">Zoomii (Because I love bookstores)</option>
			<option value="googlebooks">Google Books (Søk i fulltekst og oppdag nye bøker)</option>
			<option value="microsoftbooks">Microsoft eBooks for nedlasting (Engelsk, fransk... ordbok)</option>
			<option value="bookfindercom">BookFinder.com</option>
			<option value="ottobib">OttoBib (Enter ISBN of book(s) - separate with commas (,))</option>
			</optgroup>
		<optgroup label="Offentlige skjemaer">	
			<option value="altinn"> Altinn - Tjenester og skjemaer for privatpersoner ognæring (Altinn brukerservice)</option>
			<option value="kommunaleskjemaer">Diverse kommunale skjemaer (Min side)</option>
			<option value="kontraktsmaler">Kontraktsmaler til fritt bruk (Forbruker.no)</option>
			</optgroup>
		<optgroup label="Min energi - strømsparing">
			<option value="varmepumpe">Forskning.no (Se hvordan varmepumpa virker)</option>
			<option value="minenergi">Min energi (offentlig servicekontor)</option>
			<option value="enova">Enova SF (Enova forvalter Energifondet - støtter ulike typer prosjekter- på gitte kriterier)</option>
			<option value="varmestotte">Varmestøtte opp i røyk (Bare hver femte pelletskamin som fikk statsstøtte i 2003, ble lønnsom)</option>
			<option value="energymaps">Renewable Energy Maps (Interactive map of UK renewable energy locations)</option>
			<option value="energikalkulator">Energiveilederen.no (Energikalkulator - boliger)</option>
			</optgroup>
		<optgroup label="Statistikk">	
			<option value="statistikkbanken">Statistikkbanken (SSB) (lagre dine tabeller for senere bruk)</option>							
			<option value="statistikkemne">Statistikker ordnet etter emne - statistikkområder (Statistisk sentralbyrå (SSB))</option>
			<option value="veiviser">Veiviseren fra A til Å (Statistisk sentralbyrå (SSB))</option>
			</optgroup>
		<optgroup label="Diverse etater, organer, postjournaler og registre">	
			<option value="offentliginformasjon">Offentlig informasjon på Internett (Kommune/fylke/stat - organer/databaser)</option>				
			<option value="postjournal">Elektronisk postjournal (EPJ) (Informasjon om arbeidssøkertjenester)</option>
			<option value="bronnoysundregistrene">Brønnøysundregistrene (Forvaltningsetat - kontroll- og registreringsordninger...)</option>
			<option value="enhetsregisteret">Nøkkelopplysninger fra Enhetsregisteret (Brønnøysundregistrene)</option>	
			<option value="regelhjelp">Regelhjelp.no (Omfatter nå kravene for 15 bransjer.)</option>		
			<option value="skatteetaten">Skatteetaten (Skatt, moms, arveavgift, arbeidsgiveravgift og folkeregisteret)</option>
			</optgroup>	
		<optgroup label="Juss (lover, lovdata, rettssikkerhet)">
			<option value="lovdatano">Lovdata.no (Lovdata er en privat stiftelse opprettet av Justisdepartementet...)</option>
			<option value="loverlovdata">Lover (Diverse angående lover)</option>				
			<option value="jussportalen">Jussportalen.no (Webportal med en enkel oversikt over de juridiske ressursene)</option>
			<option value="dommereogdomstoler">Dommere og domstoler (mintankesmie.no)</option>					
			<option value="forliksradet">Forliksrådet og forliksklage (mintankesmie.no)</option>	
			<option value="konfliktrådet">Konfliktrådet (mintankesmie.no)</option>
			<option value="riksadvokaten">Riksadvokaten - Statsadvokatene (Den høyere påtalemyndighet) (mintankesmie.no)</option>
			<option value="statensinnkrevingssentral">Statens Innkrevingssentral (SI) (Frivillig innkreving og Tvangsinnkreving)</option>
			<option value="politianmeldelser">Politiet, politianmeldelser osv. (mintankesmie.no)</option>
			<option value="menneskerettigheter">Menneskerettigheter og menneskerettighetsdomstolen (mintankesmie.no)</option>
			<option value="retstidende">Norsk retstidende (ABM - Statens senter for arkiv, bibliotek og museum)</option>
			<option value="retstidendeabonnement">Norsk retstidende (Abonnement)</option>
			<option value="lovogrettpånett">Lov og rett på nett (Surfing på det juridiske hav)</option>
			</optgroup>
		<optgroup label="Journalistikk">
			<option value="ram">RAM (Rådet for anvendt medieforskning)</option>
			<option value="pressefag">PresseFAG (Et senter for kompetanse)</option>
			<option value="fagpressen">Fagpressen (Foreningen for fagblader i Norge)</option>
			<option value="medieverden">Medieverden (Nyhetsbrev - Senter for Medieøkonomi-Handelshøyskolen BI)</option>
			<option value="instituttjournalistikk">Institutt for Journalistikk (Driver faglig utviklingsarbeid (anvendt forskning)...)</option>
			<option value="bokogsamfunn">Bok og samfunn (Utgitt av Den norske Bokhandlerforening)</option>
			<option value="mediebedrifteneslandsforening">Mediebedriftenes Landsforening (MBL) (Bransje- og utgiverorganisasjon)</option>
			<option value="nppfu">Norsk Presseforbund (NP/PFU) (Medlemsorg. finansierer sekretariat og gen. sekr.)</option>
			<option value="dagensmedier">Dagens Medier (Mediebedriftenes Landsforening)</option>
			<option value="mio">Mediebyråenes Interesseorganisasjon (MIO) (Ivaretar medl. bransjeinteresser)</option>
			<option value="mediestatistikk">Allmenn mediestatistikk (Norske pekere)</option>
			<option value="fair">FAIR (The national media watch group)</option>
			<option value="mediesnakk">Mediesnakk (Diskusjonsforum for deg som jobber i mediebransjen)</option>
			<option value="mediekritikk">Mediekritikk (NRK)</option>
			<option value="journalismnews">Online Journalism News (Mousetrap Media Ltd.)</option>
			</optgroup>
		<optgroup label="Diverse ressurser">
			<option value="detektor">Detektor (Generell emneportal med katalogiserte lenker - Deichmanske bibliotek)</option>
			<option value="elevsonen">Elevsonen (Kunnskap og læring med internett som verktøy)</option>
			<option value="hardefakta">Hardefakta.no (For lettere tilgang til presis informasjon)</option>
			<option value="nsd">Norsk samfunnsvitenskapelig datatjeneste (NSD) (Data(arkiver) - samfunn</option>
			<option value="oppslagsverk">Oppslagsverk på nettet (NLA Lærerhøgskolen - Norsk Lærerakademi)</option>
			</optgroup>
		<optgroup label="Politikk">
			<option value="politiskesaker1">Stortinget (Saker og publikasjoner fra storting og regjering)</option>
			<option value="politiskesaker2">Stortinget (Søk i spørsmål og interpellasjoner - register tilbake til 2.mars 1988)</option>
			<option value="komiteene">Komiteene</option>
			<option value="regjeringen">Stortinget - Regjeringen (Statsminister, statsråder...)</option>
			<option value="stoltenberg">Statsministerens kontor (SMK) - Regjeringen Stoltenberg II</option>
			<option value="partipolitikk">Partipolitikk (Partigruppene på Stortinget)</option>
			</optgroup>
		<optgroup label="Diverse linker">
			<option value="webware100">Webware 100</option> 
			<option value="bestofhistorywebsitesbohws">Best of History Web Sites (BOHWS)</option> 
			<option value="toplinks">The Global Citizens for Change</option>
			<option value="wholinks">World Health Organization (WHO) (national, international and intergovernmental organizations)</option>
			<option value="globallinks">Office of Global Health Affairs (OGHA) (U.S. Department of Health and Human Services)</option>
			<option value="propertylinks">International Intellectual Property Links (Canadian Intellectual Property Office - CIPO)</option>
			</optgroup>
		<optgroup label="Hva skjer?">
			<option value="allekategorierdagbladetno">TV-program - Alle kategorier (Dagbladet.no)</option>
			<option value="akkuratnavgno">TV-program - Akkurat nå og 3 timer frem (VG.no)</option>
			<option value="lagdinegentvguideseher">Lag din egen TV-guide (SEHER.NO)</option>
			<option value="hvaskjer1">Hva skjer (Oslopuls.no)</option>
			<option value="hvaskjer3">Hva skjer? (Google-søk)</option>
			<option value="underholdninggoogle">Underholdning (Google-søk)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="mobiltelefon"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Mobil sikkerhet etc.</option>
		<optgroup label="Priser, tester, mobiltjenester, mobiltelefoner, kalkulatorer, nettbutikker etc.">
			<option value="svakesignaler">Svake signaler kan skyldes mobilantennen (telenor 19.2.2012)</option> 
			<option value="prisjaktno">Prisjakt (Norge)</option>
			<option value="mobilsikkerhetnorsis" class="addgray">Mobil sikkerhet - Norsk senter for informasjonssikring (NorSIS)</option> 
			<option value="latestphonereviewscom">Latest Phone Reviews (latestphonereviews.com)</option>
			<option value="batteryclub" class="addgray">batteryClub</option> 
			<option value="altitec">Altitec (Batteributikken)</option> 
			<option value="mobilefuncouk">MobileFun.co.uk</option> 
			<option value="pocketlintcom" class="addgray">Pocket-lint.com</option>
			<option value="phonenewscom">PhoneNews.com</option>
			<option value="googleplaycom" class="addgray">Google play (combines the Android Market, Google Music, Google Movies, and Google Books) - Apper</option>
			<option value="bluestacksappplayer">BlueStacks App Player (alpha) (app player for windows)</option> 
			<option value="remoteappene">Mobil-appene du kan fjernstyre dingsene dine med (aftenposten.no 3.3.2012)</option> 
			<option value="cyanogenMod7rootrom">Vi prøver CyanogenMod 7 - Med rootet telefon kommer også muligheten til å flashe en ny ROM (dinside.no 23.6.2011)</option> 
			<option value="windowsphoneappscom" class="addgray">Apper fra Windows Store</option> 
			<option value="windowsphoneapplist">Windows Phone AppList</option> 
			<option value="androidmobilen">Slik gjør du Android-mobilen til din egen (vg.no 8.8.2011)</option> 
			<option value="sperrsmstjenester">Sperr abonnementet for SMS-tjenester - Kan spare foreldre og uoppmerksomme for tusenvis av kroner (dinside.no 24.11.2011)</option> 
			<option value="delemobiltbredband">Slik deler du mobilt bredbånd (dagbladet.no 9.8.2011)</option> 
			<option value="engadgetcom">engadget</option> 
			<option value="swiftkey">SwiftKey X Beta for smartphones (market.android.com)</option> 
			<option value="allthingsdigital">All Things Digital - News, analysis and opinion about the digital revolution (The Wall Street Journal)</option> 
			<option value="supercpumobil">Dette er mobilens nye super-CPU (itavisen.no 23.9.2010)</option>
			<option value="verdensstorsteiphone">Se verdens største iPhone (itavisen.no 3.11.2010)</option> 
			<option value="latestmobilephone" class="addgray">Compare Latest Mobile Phones (top10.com)</option>
			<option value="windowsphone7">Windows Phone 7 (computerworld.com)</option> 
			<option value="windowsphone7pocketlink">Windows Phone 7 (Five reasons to switch to Windows Phone 7) (pocket-lint.com)</option> 
			<option value="dinsidetestermobil">DinSide tester mobiler</option> 
			<option value="alatest">alaTEST (forbrukerhjelp - finn de beste mobiltelefoner etc.)</option>
			<option value="mobilereviewscnet" class="addgray">Best Mobile Phone and App Reviews (cnet.co.uk)</option>
			<option value="lesalletester">Les alle våre tester i vår testseksjon (dagensit.no)</option>
			<option value="pocketablesnet" class="addgray">Pocketables</option> 
			<option value="pcilommen">Mobilen for deg som vil ha pc i lommen (dagensit.no 27.8.2009)</option> 
			<option value="nokiabetalab">Nokia Beta Labs</option> 
			<option value="mobiltbredbandtelenor" class="addgray">Mobilt Bredbånd (Telenor)</option>
			<option value="dekningmobiltbredbandtelenor">Dekningskart - Mobilt Bredbånd (Telenor)</option>
			<option value="icemoiltbredband">Ice mobilt bredbånd</option> 
			<option value="debestemobilavisene">Her er de beste mobilavisene (dagbladet.no 26.9.2007)</option>
			<option value="ringegratis">Slik kan du ringe gratis (vg.no 25.10.2010)</option>  
			<option value="onecall">One Call</option>
			<option value="onecallminesider">One Call (Mine sider)</option>
			<option value="tele2">Tele2</option> 
			<option value="enkletelefonnummer">Tilbudet av enkle telefonnummer (nettavisen.no 8.10.2009)</option> 
			<option value="ringerdubilligst">Slik ringer du billigst (nettavisen.no 30.8.2009)</option> 
			<option value="skalringemyevennetjenester">...man må ringe mye for at det skal lønne seg med vennertjenester (digi.no 10.1.2008)</option> 
			<option value="mobilkalkulatorenforbrukerno">Mobilkalkulatoren (Sammenlignbare teleoperatørpriser - Forbruker.no)</option>
			<option value="mobilkalkulatorendinsideno">Mobilkalkulatoren (Sammenlignbare teleoperatørpriser - DinSide.no)</option>
			<option value="kalkulatorernorskfamilieokonomi">Norsk Familieøkonomi (kalkulatorer/barometere)</option>
			<option value="prisguideno">Prisguide.no (sammenlign priser, produktinformasjon etc.)</option>
			<option value="alatest">alaTEST (forbrukerhjelp - finn de beste mobiltelefoner etc.)</option>
			<option value="leseroppforordblinde">Mobilen leser opp for ordblinde</option>
			<option value="accesspcfrommobil">Access your computer from your mobile</option>
			<option value="teknofilno">teknofil.no (A-Pressen ASA)</option>
			<option value="telenornoviderekoblingstjenester">Telenor.no (Viderekoblingstjenester)</option>
			<option value="mobilsvaretc">Telenor.no (Tjenester - MobilSvar etc. - brukertips for effektiv bruk)</option>
			<option value="telenorbredbandstelefoni">Telenor.no (bredbåndstelefoni)</option>
			<option value="nrkgratistvprogrammer">NRK podkast i iTunes (nrk.no)</option>
			<option value="nrknomobiltv">NRK.no - mobil-TV (lagre innstillingene du mottar på din telefon og aktivérer disse - deretter benytter du wap for å se mobil-TV)</option>
			<option value="mobilennofinn">Mobilen.no (Finn din neste mobil)</option>
			<option value="itavisennomobilvelgeren">ITavisen.no.no (Mobilvelgeren)</option>
			<option value="mobilennopriser">Mobilen.no (Finn den beste prisen på din neste mobil)</option>
			<option value="amobilno">Amobil.no (Norges største nettsted dedikert til mobiltelefoner...)</option>
			<option value="mobilnu">Mobil (mobil.nu)</option>
			<option value="emporialifedigi">Emporia Life - Norges første mobiltelefon for seniorer (digi.no 26.9.2007)</option>
			<option value="smartmobilno">SmartMobil.no (Informasjon om Smartphones - nyheter, tester, guider og nedlastinger etc.)</option>
			<option value="itprotechnett">ITpro TechNett (Omtaler)</option>
			<option value="mobilewhack">MobileWhack (Tech toys)</option>
			<option value="microsoftwindowsmobile">Microsoft Windows Mobile (Smarttelefoner, lomme-PCer etc.)</option>
			<option value="windowsmobiledeepfis">Microsoft Live Labs - Deepfish - web pages to a Windows Mobile device)</option>
			<option value="idedataas">IdeData as (nettbutikk som er litt mer personlig enn de andre mer statiske butikker på Internett)</option>
			<option value="mobilephonesuk">Mobile Phones UK: Reviews &amp; Best Buys (This month's most popular mobile phones)</option>
			<option value="skype">Skype (Med SkypeOut og Skype kan du ringe til fast- og mobiltelefoner, hvor som helst i verden)</option>
			<option value="phonzoe">Phonzo Bredbåndstelefoni (ringe til fast- og mobiltelefoner, hvor som helst i verden)</option> 
			<option value="jiwirecom">JiWire (bl.a. oversikt over steder med trådløst Internett)</option> 
			<option value="ippamobilen">Slik får du IP på mobilen (Amobil.no)</option>
			<option value="mobiltelefonprodusenter">Mobiltelefonprodusenter (Teknikk, definisjoner, produsenter (utvalg) etc.)</option>
			<option value="mobilkalkulator">Mobiltelefon- og internettkalkulatorer (Sammenlign priser for fast- og mobiltelefoni samt Internett)</option>
			<option value="kalkulatorerforbrukerno">Kalkulatorer for mobil, bil, reise, digital, penger og bolig (Aftenposten - Forbruker.no)</option>
			<option value="nettbutikkervisa">Nettbutikker etc. (Oversikt nettbutikker - som tilbyr betalingsløsningen Verified by Visa)</option>
			<option value="howtotieatie">How to Tie a Tie (Hvordan knytte slips) (e.How)</option>
			<option value="ehow">e.How (Clear Instructions on How To Do (just about) Everything)</option>
			<option value="dagensitnohjelperdeg">Verktøykasse for beslutningstakere (Dagensit.no hjelper deg)</option>
			</optgroup>
		<optgroup label="Diverse kalkulatorer - ringepriser utland, abonnement, valutakurser, vaksiner etc.">
			<option value="mobilkalkulatoren">Mobilkalkulatoren (Forbruker.no)</option>
			<option value="mobiliutlandet">Mobil i utlandet (Kalkulator - hva koster å bruke mobiltelefon i utvalgte land)</option>
			<option value="googlecalculator3">(Valutakurser (Norges Bank))</option>
			<option value="valutaomregner">Valutaomregner (Currency converter) (Euroinvestor.no)</option>
			<option value="norskkalkulator">Kalkulator (Matte.no)</option>
			<option value="allealkulatorer">Alle kalkulatorene (DinSide)</option>
			<option value="matteno">Matte.no (Portal for matte-ressurser)</option>
			<option value="calculateforfree">Calculateforfree (Online Calculators -Links to Hundreds of free calculators)</option>
			<option value="calculatorcom">Calculator.com (calculate anything anywhere... online, pocket, pc, pda, wap and cellphone calcula)</option>
			</optgroup>
		<optgroup label="Diverse - opplysning, telefonnummer, landkoder, kart, pakkesporing, posten etc.)">
			<option value="sokkartfinnno">Søk på kart etc. - Norge (Finn.no)</option>
			<option value="sokkartzettno">Søk på kart etc. - Norge (Zett.no)</option>
			<option value="retningsnummerutland">Landkoder (Slik ringer du til utlandet - tast 00 + landkode + retningsnummer + nummer du vil ringe)</option>
			<option value="mobilegmaps">Mobile GMaps (All About Symbian - Feed Your Phone)</option>				
			<option value="msmaps">Windows Live Local - Kart, satellitt... (Finn hvor du skal: Startadresse til sluttadresse)</option>
			<option value="googlemaps">Google Maps - Kart, satellitt... (Finn hvor du skal: Startadresse til sluttadresse)</option>
			<option value="tomtom">TomTom (a leading provider of personal navigation products and services)</option>
			<option value="garmin">Garmin (en av verdens største produsenter av GPS-produkter)</option>
			<option value="wayfindercom">Wayfinder.com (Kart-, vägvisnings- och GPS-navigeringstjänster för mobiltelefoner)</option>
			<option value="gulesider">Gule Sider (Findexa AS - Telenors offisielle katalogutgiver)</option>
			<option value="opplysning1890">Opplysning 1890 hjelper deg med navn, numre og adresser (EasyConnect AS)</option>
			<option value="opplysningen1881">Opplysningen 1881 (Opplysningen AS)</option>				
			<option value="proff">Proff - bedrifter og privatpersoner (Findexa Proff Telefonkatalogen Gule Sider)</option>		
			<option value="anywho">AnyWho (FIND A PERSON - FIND A BUSINESS)</option>		
			<option value="teldir">Teldir (Find anyone anywhere in the world)</option>
			<option value="teldirdialingcodes">Teldir (International dialing Codes - anywhere in the world)</option>
			<option value="infospace">InfoSpace (a leader in mobile entertainment, private-label search and online directory)</option>
			<option value="searchsystemsnet">Searchsystems.net (Now over 38,097 Searchable Public Record Databases!)</option>
			<option value="postenn">Søk postnummer og poststedsnavn i Norge (Posten)</option>
			<option value="postendk">Danmark, Færøerne og Grønland (Post Danmark A/S)</option>
			<option value="postens">Sverige (Posten)</option>
			<option value="mapquest">MapQuest.com Information Center</option>
			<option value="maporama">Maporama International (The European leader on the market of Geocentric Services)</option>
			<option value="mapscom">Maps.com (a leading provider of mapping products and solutions to business, education and consumer markets)</option>
			</optgroup>
		<optgroup label="Diverse artikler">
			<option value="mobilivannet">Mobil i vannet – slik redder du den (nrk.no 19.7.2011)</option> 
			<option value="mobilenido">Mathilde (17) mistet mobilen i do - slik reddet hun den (vg.no 2.8.2011)</option> 
			<option value="mobilhabitforming">Smartphones Really Are Habit-Forming: Study (health.yahoo.net)</option> 
			<option value="mindretrygg">Mobilen stadig mindre trygg (vg.no 10.5.2008)</option> 
			<option value="backupvodafone">Back-up av kontaktinformasjon mobiltelefoner - Vodafone360 (ZYB)</option> 
			<option value="skalvarei5år">Forbrukerseier i Høyesterett: Gratis mobil-retting i fem år (vg.no 21.9.2007)</option> 
			<option value="android">Android (the Open Handset Alliance)</option> 
			<option value="gratismobil18000">"Gratis" mobil koster 18.000 kroner</option> 
			<option value="4800forenmms">Fikk regning på 4800 kr for én MMS (dagbladet.no 15.9.2007)</option> 
			<option value="mobiltbredbandtil99kroner">Tilbyr mobilt bredbånd til 99 kroner (dinside.no 27.8.2007)</option>
			<option value="mobilsalgettilhimmels">Mobilsalget til himmels (dagensit.no 4.8.2007)</option>
			<option value="sjokkforskjellpamobil">Sjokkforskjell på mobilpriser (nettavisen.no)</option>
			<option value="palmcentro">Palm «Centro» er fattigmanns iPhone (digi.no 28.9.2007)</option> 
			<option value="mobiloghorselsskader">Kan mobilen gi hørselsproblemer? (forbruker.no 14.8.2007)</option>
			<option value="laveremobilpriser">Enda lavere mobilpriser (Nettavisen.no)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="forbruker"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Forbruker</option>
		<optgroup label="Priser, tester, mobiltjenester, mobiltelefoner, kalkulatorer etc.">
			<option value="prisguideno">Prisguide.no (sammenlign priser, produktinformasjon etc.)</option>
			<option value="alatest">alaTEST (forbrukerhjelp - finn de beste mobiltelefoner etc.)</option>
			<option value="teknofilno">teknofil.no (A-Pressen ASA)</option>
			<option value="mobiltbredbandtelenor">Mobilt Bredbånd (Telenor)</option>
			<option value="telenornoviderekoblingstjenester">Telenor.no (Viderekoblingstjenester)</option>
			<option value="mobilsvaretc">Telenor.no (Tjenester - MobilSvar etc. - brukertips for effektiv bruk)</option>
			<option value="telenorbredbandstelefoni">Telenor.no (bredbåndstelefoni)</option>
			<option value="mobilennofinn">Mobilen.no (Finn din neste mobil)</option>
			<option value="itavisennomobilvelgeren">ITavisen.no.no (Mobilvelgeren)</option>
			<option value="mobilennopriser">Mobilen.no (Finn den beste prisen på din neste mobil)</option>
			<option value="amobilno">Amobil.no (Norges største nettsted dedikert til mobiltelefoner...)</option>
			<option value="mobilnu">Mobil (mobil.nu)</option>
			<option value="smartmobilno">SmartMobil.no (Informasjon om Smartphones - nyheter, tester, guider og nedlastinger etc.)</option>
			<option value="itprotechnett">ITpro TechNett (Omtaler)</option>
			<option value="hdkameraerarets">HD-videokameraer blir årets trend, tror bransjen (forbruker.no 30.1.2008)</option> 
			<option value="microsoftwindowsmobile">Microsoft Windows Mobile (Smarttelefoner, lomme-PCer etc.)</option>
			<option value="idedataas">IdeData as (nettbutikk som er litt mer personlig enn de andre mer statiske butikker på Internett)</option>
			<option value="mobilephonesuk">Mobile Phones UK: Reviews &amp; Best Buys (This month's most popular mobile phones)</option>
			<option value="skype">Skype (Med SkypeOut og Skype kan du ringe til fast- og mobiltelefoner, hvor som helst i verden)</option>
			<option value="phonzoe">Phonzo Bredbåndstelefoni (ringe til fast- og mobiltelefoner, hvor som helst i verden)</option> 
			<option value="jiwirecom">JiWire (bl.a. oversikt over steder med trådløst Internett)</option> 
			<option value="ippamobilen">Slik får du IP på mobilen (Amobil.no)</option>
			<option value="mobiltelefonprodusenter">Mobiltelefonprodusenter (Teknikk, definisjoner, produsenter (utvalg) etc.)</option>
			<option value="mobilkalkulator">Mobiltelefon- og internettkalkulatorer (Sammenlign priser for fast- og mobiltelefoni samt Internett)</option>
			<option value="kalkulatorerforbrukerno">Kalkulatorer for mobil, bil, reise, digital, penger og bolig (Aftenposten - Forbruker.no)</option>
			<option value="nettbutikkervisa">Nettbutikker etc. (Oversikt nettbutikker - som tilbyr betalingsløsningen Verified by Visa)</option>
			<option value="howtotieatie">How to Tie a Tie (Hvordan knytte slips) (e.How)</option>
			<option value="ehow">e.How (Clear Instructions on How To Do (just about) Everything)</option>
			<option value="dagensitnohjelperdeg">Verktøykasse for beslutningstakere (Dagensit.no hjelper deg)</option>
			</optgroup>
		<optgroup label="Diverse kalkulatorer - ringepriser utland, abonnement, valutakurser, vaksiner etc.">
			<option value="mobilkalkulatoren">Mobilkalkulatoren (Sammenlignbare teleoperatørpriser)</option>
			<option value="mobiliutlandet">Mobil i utlandet (Kalkulator - hva koster å bruke mobiltelefon i utvalgte land)</option>
			<option value="kalkulatorernorskfamilieokonomi">Norsk Familieøkonomi (kalkulatorer/barometere)</option>
			<option value="googlecalculator3">(Valutakurser (Norges Bank))</option>
			<option value="valutaomregner">Valutaomregner (Currency converter) (Euroinvestor.no)</option>
			<option value="norskkalkulator">Kalkulator (Matte.no)</option>
			<option value="allealkulatorer">Alle kalkulatorene (DinSide)</option>
			<option value="pokerbility">Pokerbility (odds calculator to enhance poker skills)</option>
			<option value="dinsideimportkalkulatorbil">DinSide.no (importkalkulator - bil)</option>
			<option value="matteno">Matte.no (Portal for matte-ressurser)</option>
			<option value="calculateforfree">Calculateforfree (Online Calculators -Links to Hundreds of free calculators)</option>
			<option value="calculatorcom">Calculator.com (calculate anything anywhere... online, pocket, pc, pda, wap and cellphone calcula)</option>
			<option value="martindalescalculators">Martindale's calculators on-line center (Diverse kalkulatorer)</option>
			<option value="martindalereferencedesk">Martindale's the reference desk (Diverse ressurser)</option>
			<option value="tiresizecalculator">Miata Tire Size Calculator (Se hvordan dekk og hjul påvirker avlesning av speedometer)</option>
			<option value="healthtools">Health tools (Heart risk calculator, BMI calculator...)</option>
			<option value="reisevaksinerhvilketrengs">Reisevaksiner hvilke trengs?</option>
			<option value="europeiskhelsetrygdekort">Europeisk helsetrygdekort (bestilling)</option>
			<option value="europeiskhelsekortfalsktrygghet">Europeisk helsekort kan være falsk trygghet</option>
			<option value="dinsidesvaksinekalkulator">Hvilke vaksiner trenger du?(DinSides vaksinekalkulator)</option>
			<option value="netwellness">NetWellness.com (Consumer Health Information)</option>
			<option value="medicalcalculators">Medical Calculators (GlobalRPh Inc.)</option>
			</optgroup>
		<optgroup label="Diverse - opplysning, telefonnummer, landkoder, kart, pakkesporing, posten etc.)">
			<option value="sokkartfinnno">Søk på kart etc. - Norge (Finn.no)</option>
			<option value="sokkartzettno">Søk på kart etc. - Norge (Zett.no)</option>
			<option value="retningsnummerutland">Landkoder (Slik ringer du til utlandet - tast 00 + landkode + retningsnummer + nummer du vil ringe)</option>
			<option value="jajah">JAJAH (FREE local and international calls with your regular phone)</option>
			<option value="mobilegmaps">Mobile GMaps (All About Symbian - Feed Your Phone)</option>				
			<option value="msmaps">Windows Live Local - Kart, satellitt... (Finn hvor du skal: Startadresse til sluttadresse)</option>
			<option value="googlemaps">Google Maps - Kart, satellitt... (Finn hvor du skal: Startadresse til sluttadresse)</option>
			<option value="gulesider">Gule Sider (Findexa AS - Telenors offisielle katalogutgiver)</option>
			<option value="opplysning1890">Opplysning 1890 hjelper deg med navn, numre og adresser (EasyConnect AS)</option>
			<option value="opplysningen1881">Opplysningen 1881 (Opplysningen AS)</option>				
			<option value="proff">Proff - bedrifter og privatpersoner (Findexa Proff Telefonkatalogen Gule Sider)</option>		
			<option value="anywho">AnyWho (FIND A PERSON - FIND A BUSINESS)</option>		
			<option value="teldir">Teldir (Find anyone anywhere in the world)</option>
			<option value="teldirdialingcodes">Teldir (International dialing Codes - anywhere in the world)</option>
			<option value="infospace">InfoSpace (a leader in mobile entertainment, private-label search and online directory)</option>
			<option value="searchsystemsnet">Searchsystems.net (Now over 38,097 Searchable Public Record Databases!)</option>
			<option value="postenn">Søk postnummer og poststedsnavn i Norge (Posten)</option>
			<option value="postendk">Danmark, Færøerne og Grønland (Post Danmark A/S)</option>
			<option value="postens">Sverige (Posten)</option>
			<option value="mapquest">MapQuest.com Information Center</option>
			<option value="maporama">Maporama International (The European leader on the market of Geocentric Services)</option>
			<option value="mapscom">Maps.com (a leading provider of mapping products and solutions to business, education and consumer markets)</option>
			</optgroup>
		<optgroup label="Tid, reiser, GPS, UDs landsider, skikk og bruk etc.">
			<option value="verdensuret">Verdensuret (Time and Date AS)</option>
			<option value="reiseklinikken">Reiseklinikken.no (Reisemedisin er ikke bare vaksinering)</option> 
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			<option value="timeleft">TimeLeft (a free clock, reminder, alarm clock, tray clock, countdown clock, stopwatch, timer...)</option>
			<option value="flybussekspressenas">Flybussekspressen AS (til/fra flyplassen)</option>
			<option value="sasbraathens">SAS Braathens (Planlegg og bestill flyreise)</option>
			<option value="norwegian">Norwegian Air Shuttle (Lavpriskalenderen)</option>
			<option value="kelkoo">kelkoo (Flybilletter)</option>
			<option value="flybilligstcom">flybilligst.com (et verktøy som hjelper deg å finne de billigste flybillettene)</option>
			<option value="solfaktoras">SOLFAKTOR AS - søk blant feriereiser og restplasser fra samtlige nordiske charteroperatører og utvalgte lavpris flyselskap</option>
			<option value="skyeuropeairlines">SkyEurope Airlines (The Gateway to Central Europe!)</option>
			<option value="ebookersno">ebookersno (Europas største reisebyrå på Internett)</option>
			<option value="sidestep">SideStep (Find the best bargains from multiple travel sites)</option>
			<option value="globalhotelindex">Global Hotelindex (Integrates Google-Maps for user friendliness)</option>
			<option value="tomtom">TomTom (a leading provider of personal navigation products and services)</option>
			<option value="garmin">Garmin (en av verdens største produsenter av GPS-produkter)</option>
			<option value="wayfindercom">Wayfinder.com (Kart-, vägvisnings- och GPS-navigeringstjänster för mobiltelefoner)</option>
			<option value="reisevaksinerhvilketrengs">Reisevaksiner hvilke trengs?</option>
			<option value="dinsidesvaksinekalkulator">Hvilke vaksiner trenger du? (DinSides vaksinekalkulator)</option>
			<option value="googleearth">Google Earth - A 3D interface to the planet (Program for nedlasting)</option>		
			<option value="elkjopfotofremkalling">Elkjøp Fotofremkalling (Nordens største handelsforetak innen forbrukerelektronikk)</option>
			<option value="lefdalcomfotofremkalling">Lefdal Digitale fargebilder (Bildene kan sendes til din private adresse eller hentes hos Lefdal)</option>
			<option value="udslandsider">UDs landsider (Utenriksdepartementet)</option>
			<option value="skikkogbrukno">Skikkogbruk.no (Kunnskapsdatabase - de skrevne/uskrevne sosiale regler...)</option>
			<option value="farvelfolkeskikk">Farvel, folkeskikk (dinside.no)</option>
			<option value="kartbutikkenno">kartbutikken.no (GPS, kart etc. - UGLAND IT GROUP AS)</option>
			<option value="gpsno">GPS.no (Nettsted for satellittbasert navigasjon) - The Global Positioning System (GPS)</option>
			<option value="gpstest">GPS test (Dingz.no)</option>
			<option value="gpspakke">GPS pakke for navigering i Skandinavia (Wayfinder Navigator)</option>
			<option value="stephenpmorse">Stephen P. Morse (Converting Addresses to Latitude/Longitude in One Step)</option>
			<option value="timetravel">TIME TRAVEL Version 1.2 (Bereger forskjeller mellom to datoer i dager, uker... og år)</option>
			</optgroup>
		<optgroup label="Rute- og reiseinformasjon - ankomst- og avgangstider - planlegging">
			<option value="trafikanten">Trafikanten (Rute- og reiseinformasjon for Akershus, Oslo og sentrale østlandet)</option>
			<option value="ruteopplysning">Ruteopplysningen 177 - fylkene (Tjenesten er drevet av Foreningen 177)</option>
			<option value="nsb">NSB (Persontrafikk med tog og buss, samt godstrafikk på jernbane...)</option>
			<option value="map24">map24 (Ruteplanlegger - last ned kart til mobiltelefon etc.)</option>
			<option value="ruteplanleggeren">NRK (Her finner du lenker til gode ruteplanleggere)</option>
			<option value="dinsidereise">DinSide Reise</option>
			<option value="reisefeber">Reisefeber.no</option>
			<option value="boocom">Boo.com (a new type of travel website that will help change the way you search for travel online)</option>
			</optgroup>
		<optgroup label="Myndigheter, klager, hjelpemidler etc.">
			<option value="alleregistre">Alle registre (offentlighet.no)</option>
			<option value="regleromdokumentoffentlighet">Regler om dokumentoffentlighet (offentlighet.no)</option>
			<option value="landinfo">Landinfo - utlendingsforvaltningens fagenhet (Utlendingsdirektoratet (UDI))</option>
			<option value="skikkogbrukno">Skikkogbruk.no (Kunnskapsdatabase - de skrevne/uskrevne sosiale regler...)</option>
			<option value="flypassasjerersrettigheter">Flypassasjerers rettigheter ved kanselleringer (Forbrukerombudet)</option>
			<option value="klagepareise">Slik klager du på reisen (Aftenposten - forbruker.no)</option>
			<option value="googlecalculator1">Google calculator (Bruk søkefelt fra Google som kalkulator)</option>
			<option value="googlecalculator2">Google calculator (Bruk søkefelt fra Google som valutaomregner)</option>
			<option value="googlecalculator3">(Valutakurser (Norges Bank))</option>
			<option value="franklincom">Franklin Electronic Publishers (...electronic language learning solutions...)</option>
			<option value="valutaomregner">Valutaomregner (Currency converter) (Euroinvestor.no)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Hva skjer, underholdning, film, musikk, spill, festivaler...">
			<option value="hvaskjer1">Hva skjer (Oslopuls.no)</option>
			<option value="hvaskjer3">Hva skjer? (Google-søk)</option>
			<option value="filmarkivetno">Filmarkivet.no (NorgesFilm AS og Norsk Filminstitutt)</option>
			<option value="imdb">The Internet Movie Database (IMdb)</option>
			<option value="biographycom">Biography.com - Search for anyone (A&amp;E Television Networks)</option>					
			<option value="metacritic">Metacritic (Omtaler av film, video, musikk, spill, bøker og fjernsyn)</option>
			<option value="film101com">Film101.com (films that have been strongly recommended by critics and filmmakers...)</option>
			<option value="tvsquad">tvsquad (Where to find your favorite shows online)</option>			
			<option value="fansites">FanSites (Hollywood Media Corp. (NASDAQ: HOLL)</option>			
			<option value="yahooligans">Yahooligans! (The WEb Guide for Kids)</option>		
			<option value="nrkurort">NRK Urørt (Gratis nedlasting avv musikk)</option>		
			<option value="sideload">SIDELOAD (Free tracks from 18,777 Artists - MP3)</option>			
			<option value="downloadcommusic">Download.com Music (The premier source for free music - MP3)</option>			
			<option value="freemusicdownloads">Amazon.com (Free Music Downloads)</option>		
			<option value="smsmp3">SmsMp3 (Låter som kan lastes ned gratis)</option>
			<option value="musikkdownload"> Sol.no (musikkdownload)</option>		
			<option value="itavisenspilltest">ITAVISEN SPILL (Spilltest)</option>
			<option value="tokyogameshow">TOKYO GAME SHOW (Computer Entertainment Supplier's Association Nikkei Business Publications, Inc.)</option>
			<option value="wwitv">WWITV: World Wide Internet TeleVision (Se andre lands TV-programmer gratis på nett)</option>
			<option value="jclsinternettv">JLC's Internet TV (automatically finds over 1400 channels)</option>
			<option value="myspacecom">Myspace.com (MySpace is an online community that lets you meet your friends' friends)</option>
			<option value="youtube">YouTube.com (YouTube is a consumer media company for people to watch and share original videos...)</option>
			<option value="brightcovecom">Brightcove.com (Brightcove is an Internet TV service)</option>
			<option value="underholdning">Underholdning (Google-søk)</option>
			<option value="yahoolyrics">Yahoo! Lyrics (gratis tilgang til hundretusener av sangtekster)</option>
			<option value="guitarcordfinder">Guitar Chord Finder (Guitar chord dictionary - 100's of chords)</option>
			<option value="festivalmusikkunderholdning">Sol.no (Underholdning, musikk, festival...)</option>
			</optgroup>
		<optgroup label="Mat og drikke...">
			<option value="matprat">matPrat (Opplysningskontoret for kjøtt arbeider med merkenøytral informasjon)</option>
			<option value="aperitifno">Aperitif.no (Nordens største nettsted om mat og drikke)</option>
			<option value="artoftaste">Art of Taste (Hjemmet Mortensens nettsatsing på mat og drikke)</option>
			</optgroup>
		<optgroup label="Diverse markeder - jobb, utleie, møbler, bildeler, biler etc.">
			<option value="finnno">Finn.no (Stilling ledig etc.)</option>
			<option value="zettno">Zett.no (Stilling ledig etc.)</option>
			<option value="ebay">ebay (The World's Online Marketplace)</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			<option value="deltidsjobbno">Deltidsjobb.no (Stilling ledig etc.)</option>
			<option value="salesforcecom">Salesforce.com (Salesforce.com is the market and technology leader in on-demand customer relationship management (CRM))</option>
			<option value="hybelno">Hybel.no (Bolig til leie, møbler og hvitevarer - Alt til hybeltilværelsen)</option>
			<option value="iboligno">iBolig.no (Gratis boligannonser)</option>
			<option value="hybelformidling">Hybelformidling (Hybelformidling - Bergen, Oslo, Trondheim, Sogndal, Volda, Lillestrøm)</option>
			<option value="bilforumetnet">Bilforumet (Spør mekanikeren)</option>
			<option value="bildelerbrukte">Brukte bildeler (Bil-Demontørenes Dataring)</option>
			<option value="bildelerbruktenbf">Brukte bildeler (Norges Biloppsamleres Forening (NBF))</option>
			<option value="torshovbilrekvisita">Nye bildeler (Torshov Bilrekvisita)</option>
			<option value="bildelernyebiltema">Nye bildeler (Biltema Norge)</option>
			</optgroup>
		<optgroup label="Skole, studenter, kataloger, rabatter, legater, språk, utdanning etc.">
			<option value="skoleaviser">Skoleaviser (Utdanningsdirektoratet driver denne tjenesten i samarbeid med Avis i skolen)</option>
			<option value="studentaviser">Studentaviser (StudentTorget.no)</option>
			<option value="facebookcom">Facebook (a social utility that connects you with the people around you)</option>
			<option value="linkedin">LinkedIn (There are 11 million professionals already on LinkedIn)</option>
			<option value="googleliteracyproject">Google Literacy Project (A resource for teachers, literacy organisations and anyone interested in reading and education)</option>
			<option value="studentrabattno">Studentrabatt.no (Rabatter fra ditt studiested: ...)</option>
			<option value="studnetno">Studnet.no (Student's guide to discounts!)</option>
			<option value="studentkatalogenno">Studentkatalogen.no (For studenter som vil spare mye penger!)</option>
			<option value="skoleruta">Skoleruta (skolestart, ferier... - fylkesvis)</option>
			<option value="skolehjelperen">Skolehjelperen (Diverse linker)</option>
			<option value="ansa">ANSA.no (Association of Norwegian Studensts Abroad)</option>
			<option value="googleforeducators">Google for Educators (a teacher's guide to 12 Google products)</option>
			<option value="franklincom">Franklin Electronic Publishers (...electronic language learning solutions...)</option>
			<option value="statenslanekasse">Statens lånekasse for utdanning</option>
			<option value="legathandboken">Søk i Legathåndboken 2006</option>
			<option value="legatsiden">Legatsiden.no (Norske støtteordninger på WEB)</option>
			<option value="studnetno">Studnet.no (student's guide to discounts!)</option>
			<option value="rolltalk">ROLLtalk.com - IGEL Kompaniet (Utvikler, produserer og tilrettelegger høyteknologiske hjelpemidler)</option>
			<option value="picomed">PICOMED</option> 
			<option value="gewa">GEWA</option> 
			<option value="assistentpartneras">Assistent Partner AS</option> 
			<option value="sprak">Språk, språkforståelse og utdanning (mintankesmie.no)</option>
			<option value="skrivekunst">Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap (mintankesmie.no)</option>
			<option value="diversedatatips">Diverse datatips (mintankesmie.no)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			<option value="ideutviklingkreativitet">Idéutvikling, kreativitet og gründervirksomhet (mintankesmie.no)</option>
			<option value="innovasjon">Innovasjon (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Bøker - nettbokhandel">
			<option value="bokkildenno">bokkilden.no</option>
			<option value="norlisnettbokhandel">Norlis nettbokhandel.no</option>
			<option value="haugenbokno">haugenbok.no</option>
			<option value="zoomii">Zoomii (Because I love bookstores)</option>
			<option value="googlebooks">Google Books (Søk i fulltekst og oppdag nye bøker)</option>
			<option value="microsoftbooks">Microsoft eBooks for nedlasting (Engelsk, fransk... ordbok)</option>
			<option value="bookfindercom">BookFinder.com</option>
			<option value="ottobib">OttoBib (Enter ISBN of book(s) - separate with commas (,))</option>
			<option value="amazoncom">amazon.com (USA)</option>
			<option value="amazoncouk">amazon.co.uk (Storbritannia)</option>
			</optgroup>
		<optgroup label="Offentlige skjemaer">	
			<option value="altinn"> Altinn - Tjenester og skjemaer for privatpersoner og næring (Altinn brukerservice)</option>
			<option value="kommunaleskjemaer">Diverse kommunale skjemaer (Min side)</option>
			<option value="kontraktsmaler">Kontraktsmaler til fritt bruk (Forbruker.no)</option>
			</optgroup>
		<optgroup label="Min energi - strømsparing">
			<option value="varmepumpe">Forskning.no (Se hvordan varmepumpa virker)</option>
			<option value="minenergi">Min energi (offentlig servicekontor)</option>
			<option value="enova">Enova SF (Enova forvalter Energifondet - støtter ulike typer prosjekter- på gitte kriterier)</option>
			<option value="varmestotte">Varmestøtte opp i røyk (Bare hver femte pelletskamin som fikk statsstøtte i 2003, ble lønnsom)</option>
			<option value="energysaversgov">Energy Savers.gov (U.S. Government Web)</option>
			<option value="energymaps">Renewable Energy Maps (Interactive map of UK renewable energy locations)</option>
			<option value="energikalkulator">Energiveilederen.no (Energikalkulator - boliger)</option>
			</optgroup>
		<optgroup label="Statistikk">	
			<option value="statistikkbanken">Statistikkbanken (SSB) (lagre dine tabeller for senere bruk)</option>							
			<option value="statistikkemne">Statistikker ordnet etter emne - statistikkområder (Statistisk sentralbyrå (SSB))</option>
			<option value="veiviser">Veiviseren fra A til å (Statistisk sentralbyrå (SSB))</option>
			</optgroup>
		<optgroup label="Diverse etater, organer, postjournaler og registre">	
			<option value="offentliginformasjon">Offentlig informasjon på Internett (Kommune/fylke/stat - organer/databaser)</option>				
			<option value="postjournal">Elektronisk postjournal (EPJ) (Informasjon om arbeidssøkertjenester)</option>
			<option value="bronnoysundregistrene">Brønnøysundregistrene (Forvaltningsetat - kontroll- og registreringsordninger...)</option>
			<option value="enhetsregisteret">Nøkkelopplysninger fra Enhetsregisteret (Brønnøysundregistrene)</option>	
			<option value="regelhjelp">Regelhjelp.no (Omfatter nå kravene for 15 bransjer.)</option>				
			<option value="skatteetaten">Skatteetaten (Skatt, moms, arveavgift, arbeidsgiveravgift og folkeregisteret)</option>
			</optgroup>	
		<optgroup label="Juss (lover, lovdata, rettssikkerhet)">
			<option value="lovdatano">Lovdata.no (Lovdata er en privat stiftelse opprettet av Justisdepartementet...)</option>
			<option value="loverlovdata">Lover (Diverse angående lover)</option>				
			<option value="jussportalen">Jussportalen.no (Webportal med en enkel oversikt over de juridiske ressursene)</option>
			<option value="dommereogdomstoler">Dommere og domstoler (mintankesmie.no)</option>					
			<option value="forliksradet">Forliksrådet og forliksklage (mintankesmie.no)</option>	
			<option value="konfliktrådet">Konfliktrådet (mintankesmie.no)</option>
			<option value="riksadvokaten">Riksadvokaten (mintankesmie.no)</option>
			<option value="statsadvokaten">Statsadvokaten (mintankesmie.no)</option>
			<option value="regjeringsadvokaten">Regjeringsadvokaten (mintankesmie.no)</option>
			<option value="statensinnkrevingssentral">Statens Innkrevingssentral (SI) (Frivillig innkreving og Tvangsinnkreving)</option>
			<option value="politianmeldelser">Politiet, politianmeldelser osv. (mintankesmie.no)</option>
			<option value="menneskerettigheter">Menneskerettigheter og menneskerettighetsdomstolen (mintankesmie.no)</option>
			<option value="juristenesinformasjonssenter">Juristenes Informasjonssenter (Jus.no)</option>
			<option value="advokatbladetsomebladher">Les Advokatbladet som eblad/PDF her (jus.no)</option>
			<option value="advokatbladetopplag">Advokatbladet (opplag)</option> 
			<option value="rettpasak">Domstolmagasinet Rett på sak (domstol.no)</option>
			<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option> 
			<option value="retstidendeabonnement">Norsk retstidende (Abonnement - Advokatforeningen)</option>
			<option value="retstidende">Norsk retstidende (Tilgjengelig - ABM - Statens senter for arkiv, bibliotek og museum)</option>
			<option value="lovogrettpånett">Lov og rett på nett (Surfing på det juridiske hav)</option>
			</optgroup>
		<optgroup label="Journalistikk">
			<option value="ram">RAM (Rådet for anvendt medieforskning)</option>
			<option value="pressefag">PresseFAG (Et senter for kompetanse)</option>
			<option value="fagpressen">Fagpressen (Foreningen for fagblader i Norge)</option>
			<option value="medieverden">Medieverden (Nyhetsbrev - Senter for Medieøkonomi-Handelshøyskolen BI)</option>
			<option value="instituttjournalistikk">Institutt for Journalistikk (Driver faglig utviklingsarbeid (anvendt forskning)...)</option>
			<option value="bokogsamfunn">Bok og samfunn (Utgitt av Den norske Bokhandlerforening)</option>
			<option value="mediebedrifteneslandsforening">Mediebedriftenes Landsforening (MBL) (Bransje- og utgiverorganisasjon)</option>
			<option value="nppfu">Norsk Presseforbund (NP/PFU) (Medlemsorg. finansierer sekretariat og gen. sekr.)</option>
			<option value="dagensmedier">Dagens Medier (Mediebedriftenes Landsforening)</option>
			<option value="mio">Mediebyråenes Interesseorganisasjon (MIO) (Ivaretar medl. bransjeinteresser)</option>
			<option value="mediestatistikk">Allmenn mediestatistikk (Norske pekere)</option>
			<option value="fair">FAIR (The national media watch group)</option>
			<option value="mediesnakk">Mediesnakk (Diskusjonsforum for deg som jobber i mediebransjen)</option>
			<option value="mediekritikk">Mediekritikk (NRK)</option>
			<option value="journalismnews">Online Journalism News (Mousetrap Media Ltd.)</option>
			</optgroup>
		<optgroup label="Diverse ressurser">
			<option value="detektor">Detektor (Generell emneportal med katalogiserte lenker - Deichmanske bibliotek)</option>
			<option value="elevsonen">Elevsonen (Kunnskap og læring med internett som verktøy)</option>
			<option value="hardefakta">Hardefakta.no (For lettere tilgang til presis informasjon)</option>
			<option value="nsd">Norsk samfunnsvitenskapelig datatjeneste (NSD) (Data(arkiver) - samfunn</option>
			<option value="oppslagsverk">Oppslagsverk på nettet (NLA Lærerhøgskolen - Norsk Lærerakademi)</option>
			</optgroup>
		<optgroup label="Politikk">
			<option value="politiskesaker1">Stortinget (Saker og publikasjoner fra storting og regjering)</option>
			<option value="politiskesaker2">Stortinget (Søk i spørsmål og interpellasjoner - register tilbake til 2.mars 1988)</option>
			<option value="komiteene">Komiteene</option>
			<option value="regjeringen">Stortinget - Regjeringen (Statsminister, statsråder...)</option>
			<option value="stoltenberg">Statsministerens kontor (SMK) - Regjeringen Stoltenberg II</option>
			<option value="partipolitikk">Partipolitikk (Partigruppene på Stortinget)</option>
			</optgroup>
		<optgroup label="Diverse internasjonale linker">
			<option value="bestofhistorywebsitesbohws">Best of History Web Sites (BOHWS)</option> 
			<option value="toplinks">The Global Citizens for Change</option>
			<option value="wholinks">World Health Organization (WHO) (national, international and intergovernmental organizations)</option>
			<option value="globallinks">Office of Global Health Affairs (OGHA) (U.S. Department of Health and Human Services)</option>
			<option value="propertylinks">International Intellectual Property Links (Canadian Intellectual Property Office - CIPO)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="klager"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Klage, klager (klagenemnder etc.)</option>
		<optgroup label="Advokattjenester">
			<option value="disiplinarnemndaforadvokatvirksomhet">Disiplinærnemnda for advokatvirksomhet (Forbrukerrådet)</option> 
			<option value="disiplinersystemetforadvokater">Disiplinærsystemet for advokatvirksomhet (Forbrukerrådet)</option>
			<option value="disiplinarogtilsynssystemetadvokater">Disiplinær- og tilsynssystemet (Advokatforeningen)</option> 
			<option value="tilsynsradetogadvokatbevillingsnemnden">Tilsynsrådet og Advokatbevillingsnemnden (TR)</option>
			</optgroup> 
		<optgroup label="Arbeidstilsynet">
			<option value="tvisteosningsnemnda">Tvisteløsningsnemnda (arbeidstilsynet.no)</option>
			<option value="vedtakfratvisteosningsnemnda">Vedtak fra tvisteløsningsnemda</option>
			</optgroup>
		<optgroup label="Bank - Klagenemndene for forsikring, bank, finans og verdipapirfond">
			<option value="forsikringsklagekontoretfinansklagenemndafinkn">Finansklagenemnda (FinKN) - klagenemndene for forsikring, bank, finans og verdipapirfond</option>
			<option value="nemdenefinkm">Nemndene (FinKN)</option> 
			</optgroup>
		<optgroup label="Biler, bilutleie, parkering, ulykker etc.">
			<option value="klagenemndabilutleie">Klagenemnda for bilutleie (Norges Bilutleieforbund)</option>
			<option value="bilulykkenharskjedd">Bilulykken har skjedd! Hva med erstatningen?</option>
			<option value="parkeringsklagenemnda">Parkeringsklagenemnda</option>
			</optgroup>
		<optgroup label="Bioteknologi">
			<option value="bioteknologinemndahjemmeside">Bioteknologinemnda</option>
			<option value="bioteknologilovenforbrukerportalen">Bioteknologiloven (Forbrukerrådet)</option> 
			</optgroup>			
		<optgroup label="Boliger, eiendomsmegling, takster etc.">
			<option value="handverkerklagenemndano">Håndverkerklagenemnda (handverkerklagenemnda.no)</option> 
			<option value="reklamasjonsnemndafortakstmenn">Reklamasjonsnemnda for takstmenn</option>
			<option value="boligtvistnemnda">Boligtvistnemnda</option>
			<option value="reklamsjonsnemndaforeiendomsmeglertjenester">Reklamsjonsnemnda for eiendomsmeglertjenester</option>		
			</optgroup>
		<optgroup label="Brukerklagenemnda for elektroniske kommunikasjonstjenester, teletorgtjenester etc.">
			<option value="brukerklagenemndaforelektroniskkommunikasjon">Brukerklagenemnda for elektronisk kommunikasjon</option>
			<option value="brukerklagenemndaforbrukerradet">Brukerklagenemnda (elektroniske kommunikasjonstjenester)</option>
			<option value="klagemobiltelefon">Mobiltelefon</option> 
			</optgroup>
		<optgroup label="Datatilsynet">
			<option value="datatilsynetpersonvernnemnda">Vedtaka til Datatilsynet kan klagast til Personvernnemnda</option>
			</optgroup>
		<optgroup label="Klage på dommere, løgn, sakkyndighet osv.">
			<option value="klagepadommereetc">Klage på dommere - Hvordan går jeg fram?</option>
			<option value="klagepadommeremintankesmie">Klage på sakkyndige, sakkyndige vitner etc.</option>
			<option value="lognirettssaker">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="politianmeldelselognirettssaker">Politianmeldelse av løgn i rettssaker</option>
			</optgroup>
		<optgroup label="Flyreiser, togreiser, bussreiser, fergereiser, trikk og T-bane (kollektivtransport)">
			<option value="passasjerersrettigheterforbrukerradet">Flyreiser (Forbrukerrådet)</option>
			<option value="greenclaim">Green Claims - Find out if you are entitled to any compensation using our three steps below</option> 
			<option value="flypassasjerersrettighetervedkanselleringer">Flypassasjerers rettigheter ved kanselleringer (Forbrukerombudet)</option>
			<option value="flyklagenemndanmr">Flyklagenemnda (NRF (Norsk ReiselivsForum))</option>
			<option value="flysakenerlast">Fly: Er saken låst? (Forbrukerrådet)</option> 
			<option value="klagenemndaforpakkereisernrf">Klagenemnda for pakkereiser NRF (PAKKEREISENEMNDA) (Norsk ReiselivsForum)</option>
			<option value="reklamsjonsnemndaselskapsreiser">Reklamsjonsnemnda for selskapsreiser</option>
			<option value="transportklagenemnda">Transportklagenemnda (Forsinkelser, kanselleringer, overbookinger, bortkommet/skadet bagasje og andre forhold som direkte knytter seg til gjennomføringen av flyreisen)</option>  				
			</optgroup>
		<optgroup label="Forbrukere, klagenemnder, veiledere etc.">
			<option value="faiircom">Faiir.com (Gjort en dårlig handel?)</option> 
			<option value="klagebrevhjelpforbrukerradet">Vi hjelper deg å klage - Forbrukerrådets klagebrev</option>
			<option value="klagenemnderforbrukerradet">Klagenemnder (Forbrukerrrådet)</option>
			<option value="forbrukertvistutvalget">Forbrukertvistutvalget Forbrukertvistutvalget (FTU) (- kostnadsfri og bindende avgjørelse i forbrukertvister)</option>
			<option value="vedtakftu">Vedtak - Forbrukertvistutvalget (FTU)</option> 
			<option value="postlistenvedtaketc">Postliste - Postlisten omfatter alle dokumenter som vedrører både Forbrukertvistutvalget, Markedsrådet og administrative saker i Sekretariatet</option> 
			</optgroup>
		<optgroup label="Forsikringer, nemnder etc.">
			<option value="forsikringsklagekontoretfinansklagenemndafinkn">Finansklagenemnda (FinKN) - klagenemndene for forsikring, bank, finans og verdipapirfond</option>
			<option value="nemdenefinkm">Nemndene (FinKN)</option> 
			<option value="avkortningorsikringsklagenemnda">Avkortning (behandles av Forsikringsklagenemnda (FKN) Skade</option>
			<option value="forsikringsskadenemndafknskade">Forsikringsklagenemnda (FKN) Skade (avgir uttalelser vedrørende forståelsen av forsikringsvilkår og lovgivning i forbindelse med konkrete saker relatert til skadeforsikring)</option>
			</optgroup>
		<optgroup label="Fotografering">
			<option value="reklamasjonsnemndaforfotografarbeider">Reklamasjonsnemnda for fotografarbeider</option>
			</optgroup>
		<optgroup label="Gravferder">
			<option value="klagenemndagravferdtjenester">Klagenemnda for gravferdtjenester</option>
			</optgroup>
		<optgroup label="Helsevesenet">
			<option value="npehjemmeside">Norsk Pasientskadeerstatning (NPE)</option>
			<option value="pasientskadenemndapns">Pasientskadenemnda (PSN) behandler klager på vedtak fattet av Norsk Pasientskadeerstatning (NPE)</option>
			<option value="npe">Norsk Pasientskadeerstatning (NPE) (mintankesmie.no)</option>
			<option value="hvakanduklagepahelsetilsynet">Rettigheter og klager (HELSETLSYNET) (Statens helsetilsyn)</option>
			<option value="klagerettigheternav">Klagerettigheter (NAV)</option> 
			<option value="statenshelsepersonellnemnd">Statens helsepersonellnemnd (SHPN)</option> 
			<option value="fylkesnemndaforsosialesaker">Fylkesnemnda for sosiale saker</option>
			<option value="klagenemdaforutenlandsbehandling">Klagenemnda for behandling i utlandet</option>
			<option value="preimplantasjonsdiagnostikknemndapgdnemnda">Preimplantasjonsdiagnostikknemnda (PGD-nemnda)</option>
			<option value="klagenevndforkjeveortopediskesaker">Klagenevnd for kjeveortopediske saker</option>
			<option value="klagenevndforimplantatsaker">Klagenevnd for implantatsaker</option>
			</optgroup>
		<optgroup label="Husleietvister">
			<option value="husleietvistutvalget">Husleietvistutvalget (HTU)</option>
			<option value="leietrobbel">Leietrøbbel: Hva kan utleier klage på?</option>
			</optgroup>
		<optgroup label="Håndverkstjenester">
			<option value="handverkstjenester">Håndverkerklagenemnda (For håndverkertjenester på fast eiendom)</option>
			<option value="handverkstjenesterlettere">Klagenemnd for håndverkertjenester på fast eiendom (Forbrukerrådet)</option>
			</optgroup>
		<optgroup label="Inkasso">
			<option value="inkassoklagenemnda">Inkassoklagenemnda</option>
			<option value="klagenemdforinkassosakermotforbrukere">Klagenemd for inkassosaker mot forbrukere</option>
			<option value="avgjorelserinkassoklagenemnda">Avgjørelser - Inkassoklagenemnda</option> 
			</optgroup>
		<optgroup label="Internett (se &quot;Netthandel&quot; nedenfor)">
			<option value="domeneklagenemnda">Domeneklagenemnda (først og fremst tvistesaker om rettigheter til domenenavn)</option>
			<option value="slettmegno">slettmeg.no (NorSIS)</option> 
			</optgroup>
		<optgroup label="Juss, erstatninger">
			<option value="klagenemnderjussportalen">Klagenemnder (Jussportalen.no)</option>
			<option value="erstatningsnemdaforvoldsofre">Erstatningsnemda for voldsofre</option>
			<option value="diverseskadeerstatninger">Diverse skadeerstatninger (skadeserstatninger) (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Kontrakter og skjema (kjøp av tjenester), klagenemnder, veiledere etc.">
			<option value="kjopavtjenesterkontrakterogskjema">Kontrakter og skjema (Forbrukerrådet)</option> 
			<option value="skrivhandverkerkontrakt">Skriv kontrakt når du skal benytte håndverkere (Forbrukerrådet)</option>
			<option value="forbrukerombudetsklageveileder">Klager, tips og spørsmål (Forbrukerombudet) (Vil du klage, tipse oss eller spørre om noe?)</option> 
			<option value="klagebrevhjelpforbrukerradet">Vi hjelper deg å klage - Forbrukerrådets klagebrev</option>
			<option value="klagenemnderforbrukerradet">Klagenemnder (Forbrukerrrådet)</option>
			<option value="forbrukertvistutvalget">Forbrukertvistutvalget (Forbrukerrrådet)</option>
			<option value="vedtakftu">Vedtak - Forbrukertvistutvalget (FTU)</option> 
			</optgroup>
		<optgroup label="Likestilling">
			<option value="klagenemndaforlikestillingsombudet">Likestillings- og diskrimineringsombudet</option>
			<option value="likestillingsogdiskrimineringsnemnda">Likestillings- og diskrimineringsnemnda</option> 
			</optgroup>
		<optgroup label="Marked og konkurranse">
			<option value="markedsradet">Markedsrådet (Statlig myndighet som avgjør klager på markedsføringen)</option>
			<option value="naringslivetskonkurranseutvalg">Næringslivets Konkurranseutvalg</option>
			</optgroup>
		<optgroup label="Mattilsynet (ang. matforgiftning, fugleinfluensafugleinfluensa etc.)">
			<option value="klagenmatforgiftning">Matforgiftning (Publikumshenvendelser - Mattilsynets distriktskontorer på tlf. 06040</option>
			<option value="fugleinfluensa">Fugleinfluensa (Aviær influensa) - Publikumshenvendelser - Mattilsynets distriktskontorer på tlf. 06040</option>
			</optgroup>
		<optgroup label="Miljø">
			<option value="klagenemndamiljoinformasjon">Klagenemnda for miljøinformasjon</option>
			</optgroup>
		<optgroup label="Netthandel">
			<option value="netthandelangrerett">Netthandel - har vi angrerett?</option> 
			<option value="netthandelforbrukerradetno">Netthandel (Forbrukerrådet)</option>
			<option value="forbrukereuropano">Forbruker Europa (skal hjelpe forbrukere og næringsdrivende - effektiv løsning på konflikter i alle EU-land og Island)</option> 
			</optgroup>
		<optgroup label="Offentlig anskaffelser">
			<option value="klagenemndaoffentliganskaffelser">Klagenemnda for offentlige anskaffelser (KOFA)</option>
			</optgroup>			
		<optgroup label="Parkering">
			<option value="parkeringsklagenemnda">Parkeringsklagenemnda</option>
			</optgroup>
		<optgroup label="Registre">
			<option value="alleregistre">Alle registre (offentlighet.no)</option>
			</optgroup>
		<optgroup label="Tannleger (Den norske tannlegeforening)">
			<option value="klagepatannbehandling">Klage på tannbehandling - Den norske tannlegeforening (NTF)</option>
			<option value="npe">Norsk Pasientskadeerstatning (NPE)</option>
			<option value="denlokaleklagenemnda">Den lokale klagenevnda</option>
			<option value="ntfsankenemndforklagesaker">NTFs ankenemnd for klagesaker</option>
			<option value="klagenevndforkjeveortopediskesaker">Klagenevnd for kjeveortopediske saker</option>
			<option value="klagenevndforimplantatsaker">Klagenevnd for implantatsaker</option>
			</optgroup>
		<optgroup label="Vask og rens">
			<option value="klagenemndaforvaskogrens">Klagenemnda for vask og rens</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="lover"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Lover, forskrifter, lovdata etc.</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="lovdatano">Lovdata</option>
			<option value="loverlovdata">Lover (lovdata.no) og rettssikkerhet</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="advokatbladetsomebladher">Les Advokatbladet som eblad/PDF her (jus.no)</option>
			<option value="advokatbladetopplag">Advokatbladet (opplag)</option> 
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="rettpasak">Domstolmagasinet Rett på sak (domstol.no)</option>
			<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option> 
			<option value="retstidendeabonnement">Norsk retstidende (Abonnement - Advokatforeningen)</option>
			<option value="retstidende">Norsk retstidende (Tilgjengelig - ABM - Statens senter for arkiv, bibliotek og museum)</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="cuibono">Cui bono?</option>
			<option value="knowdogap">Know-do gap</option>
			<option value="okokrim">Økokrim (økonomisk kriminalitet / miljøkriminalitet)</option>
			<option value="politietetterforskning">Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)</option>
			<option value="klagepadommere">Klage på dommere, løgn, sakkyndighet osv.</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="legersintegritet">Legers integritet, kompetanse og kvalitet</option>
			<option value="pasientjournalerogepikriser">Pasientjournaler og epikriser</option>
			</optgroup>
		<optgroup label="Diverse typer erstatningsordninger">	
			<option value="npe">Norsk Pasientskadeerstatning (NPE)</option>
			<option value="legemiddelerstatninger">Legemiddelerstatninger (søksmål)</option>
			<option value="diverseskadeerstatninger">Diverse skadeerstatninger (skadeserstatninger)</option>
			<option value="voldsoffererstatning">Voldsoffererstatning (vold)</option>
			<option value="billighetserstatning">Rettferdsvederlag (Stortingets rettferdsvederlagsordning) (tidligere billighetserstatning)</option>
			<option value="rettferdfortaperne">Stiftelsen Rettferd for taperne</option>
			<option value="farskapstester">Farskapstester (farskapssaker)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							    <div id="rss"><form method="post" action="sok.php">
<div>
	<select name="opplysning" onchange="this.form.submit()">
			<option value="toppsikkerhetslosninger">Abonner på ønskede RSS-nyheter - last ned din egen RSS-leser</option>
		<optgroup label="Diverse RSS-lesere for nedlasting, lenker til lesere for synshemmede">
			<option value="feedlycom">Feedly.com</option> 
			<option value="pingit">Ping.it </option> 
			<option value="feeddemon">FeedDemon - Look no further than FeedDemon, the most popular Windows RSS reader</option>
			<option value="feedreader3">FeedReader (Powerful, yet simple) (Kraftig, men enkel)</option>
			<option value="speedrssfeedreader">Speed RSS Feed Reader</option> 
			<option value="sharpreader">SharpReader</option> 
			<option value="rssdownloadcom">Download.com (CNET Networks, Inc.)</option>
			<option value="webbie">WebbIE (a web browser for blind and visually-impaired people)</option>
			<option value="rssowl">RSSOwl (reader for rss)</option>
			<option value="hvaeropml">Hva er OPML? (importere/eksportere en samling med RSS-feeder)</option> 
			<option value="rsscomrss">rss.com Domain Name set for $750,000 USD Sale (prnewswire.co.uk 6.10.2008)</option>
			<option value="page2rss">Page2RSS (a service that helps you monitor web sites that do not publish feeds)</option> 
			<option value="outlineprocessormarkuplanguage">OPML (Outline Processor Markup Language)</option> 
			<option value="findingrssfeedforawebsite">Finding the RSS Feed for a Website</option> 
			<option value="findandreadtherssfeed">Find and Read the RSS feed of a Blog (blogstreet.com)</option> 
			<option value="hvaerrss">Innføring til RSS</option>
			<option value="slikvirkerrss">Guide: Slik virker RSS (Rich Site Summary eller Really Simple Syndication)</option>
			<option value="universs">UniveRSS - a 3D Vista RSS reader (Microsoft)</option>
			<option value="newsreaderscom">NewsReaders.com</option>
			<option value="feeddigestcom">FeedDigest.com</option>
			</optgroup>
			<optgroup label="Diverse RSS-feeds - oversikt">
			<option value="rssfeedsalle">RSS-feeds - Norge, Sverige, Danmark, Finland, Island etc. (eJour)</option>
			<option value="helsserss">Effektiv og nyttig nettbruk med RSS (helsebiblioteket.no 15.7.2009)</option> 
			</optgroup>
			<optgroup label="Diverse RSS-feeds">
			<option value="rssinfo">RSS Info (RSS Readers)</option>
			<option value="rssfeedsnorge">Norge (eJour)</option>
			<option value="rssfeedssverige">RSS-feeds - Sverige (eJour)</option>
			<option value="rssfeedsdanmark">RSS-feeds - Danmark (eJour)</option>
			<option value="rssfeedsisland">RSS-feeds - Island (eJour)</option>
			<option value="rssfeedsfinland">RSS-feeds - Finland (eJour)</option>
			<option value="rssfeedsovrigeutland">RSS-feeds - Øvrige utland (eJour)</option>
			<option value="technologyatharvardlaw">Some sources of RSS 2.0 feeds (Technology at Harvard Law)</option>
			<option value="rsswikipedia">RSS (Wikipedia)</option>
			<option value="feedburner">FeedBurner (the leading provider of media distribution and audience engagement services for blogs and RSS feeds)</option>
			<option value="feedster">Feedster (Our search technology literally monitors the world of RSS minute by minute)</option>
			<option value="medwatchhomepage">RSS - FDA/CDER/Office of Drug Safety (Kontoret for legemiddelsikkerhet - USA)</option>
			<option value="webportalpages">Keep Up With the News Using Web Portal Pages (washingtonpost.com 29.4.2009)</option>
			</optgroup>
			<optgroup label="Google - Feeds">
			<option value="downloadfeedwithjavascript">Download Feeds with JavaScript (download any public Atom or RSS feed using only JavaScript)</option>
			</optgroup>
	</select>
</div>	
</form>
</div>
							<!--</div>--><!-- End top-action -->
						</div>
					</div>
					<ul class="top-icons">
						<li class="phone"><a href="http://www.telenor.no/privat/mobil/utlandet/landskoder.jsp" title="Landkoder (Telenor)">gulesider.no</a></li>
						<li class="clock"><a href="https://www.timeanddate.com/worldclock/personal.html" title="The World Clock — Worldwide">timeanddate.com</a></li>
						<li class="sport"><a href="sport_og_spill.php" title="Sport og spill (mintankesmie.no)">mintankesmie.no</a></li>
						<li class="transport"><a href="http://www.dit.no/" title="Dit.no er en rute- og trafikktjeneste som er et samarbeid mellom Statens vegvesen og Ruter.">dit.no</a></li>
						<li class="plane-red"><a href="http://www.flightstats.com/" title="FlightStats (Conducive Technology Corp.)">flightstats.com</a></li>
						<li class="plane-blue"><a href="http://www.youtube.com/watch?v=YF7rCnqNBcU" title="Civil Air Traffic Worldwide 24h">vimeo.com</a></li>
						<li class="world"><a href="http://vizhub.healthdata.org/le/" title="Life Expectancy & Probability of Death">healthdata.org</a></li>
character "&" is the first character of a delimiter but occurred as data
Line: 2157, Col: 91
…hdata.org/le/" title="Life Expectancy & Probability of Death">healthdata.org</…
						<li class="vaeretverden"><a href="http://www.yr.no/sted/Norge/Oslo/Oslo/Oslo/time_for_time.html" title="V&aelig;ret i Norge og utlandet - Yr.no (Meteorologisk institutt og NRK)">yr.no</a></li>
						<li class="utno_norway"><a href="http://ut.no/" title="UT.no (Turtjenesten til NRK og Den Norske Turistforening institutt og NRK)">ut.no</a></li>
						<li class="tv"><a href="http://www.se.no/tv/" title="TV-guiden (Se.no)">se.no</a></li>
						<li class="computer"><a href="diverse_datatips.php" title="Diverse datatips (mintankesmie.no)">mintankesmie.no</a></li>
						<li class="basket"><a href="diverse_forbrukertips.php" title="Diverse forbrukertips (mintankesmie.no)">mintankesmie.no</a></li>
						<li class="medical"><a href="legemiddel_preparatomtaler_spc_legemidler.php" title="Legemiddel - pakningsvedlegg (legemiddelinformasjon) (mintankesmie.no)">mintankesmie.no</a></li>
				</ul>
				</div>
				<div class="logo">
					<h1><a href="index.php">MinTankesmie</a></h1>
				</div>			</div>
						
			<div class="content">
				<ul class="breadcrumb">
					<li class="first"><a href="index.php">MinTankesmie.no</a></li>
					<li><a href="#">Dekonstruksjon (og rettssikkerhet)</a></li>
				</ul>
				
				<div id="top6">
				    <div class="boxes">
				    <div class="first top-row">
					  <form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Reklame, journalisitikk, medieovervåkning, sponsing, juks, propaganda etc.</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="atilaa">A til å index - temanyheter (mintankesmie.no)</option>
			<option value="atilaa1300">A til Å index (1-300) (mintankesmie.no)</option>
			<option value="tankesmier">Tankesmier</option>
			<option value="fysisktrening">Fysisk trening (aktivitet / løping / jogging)</option>
			<option value="cuibono">Cui bono?</option>
			<option value="knowdogap">Know-do gap</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			<option value="maktogdemokratiutredningen">Makt og demokratiutredningen</option>
			<option value="lobbyisme">Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon)</option>
			<option value="interessekonflikter">Interessekonflikter, bestikkelser og korrupsjon</option>
			<option value="gaver">Gaver, smøring (gave gitt som bestikkelse) etc.</option>
			<option value="habilitet">Habilitet (integritet)</option>
			<option value="profittjournalistikk">Profitt, journalistikk, juks, omdømme og propaganda</option>
			<option value="uredelighet">Uredelighet og fusk i medisinsk forskning</option>
			<option value="tidsskrifteroguavhengighet">Medisinske tidsskrifter og uavhengighet</option>
			<option value="spokelse">Spøkelsesforfattere (ghostwriters), legemidler og forskning</option>
			<option value="rek">Regionale komiteer for medisinsk forskningsetikk (REK)</option>
			<option value="kreft">Kreft</option>
			<option value="etikkbutikk">Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="offentligforvaltning">Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)</option>
			<option value="medietilsynet">Medietilsynet</option>
			<option value="mediamediekritikk">Media (mediekritikk)</option> 
			<option value="medieovervakning">Medieovervåkning, medieanalyse, monopol og tekstreklame</option>
			<option value="pfu">PFU - Pressens Faglige Utvalg</option>
			<option value="reklame">Reklame, sponsing, journalistikk, spin og PR-virksomhet</option>
			<option value="sponsingavjournalistikk">Sponsing av journalistikk</option>
			<option value="legemiddelreklame">Legemiddelreklame (legemiddelinformasjon)</option>
			<option value="gjeldsproblemer">Gjeldsproblemer, gjeldsoffer og løsninger</option>
			<option value="wikileaks">WikiLeaks</option>
			<option value="medisinskevarslere">Varslere (medisinske varslere) (whistleblowers) etc.</option>
			<option value="rulebynobody">Rule by nobody - ondskapens filosofi</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="politietetterforskning">Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="feilmedisineringerogfeilbehandlinger">Feilmedisineringer og feilbehandlinger (medisinske feil)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="sprak">Språk, språkforståelse og utdanning</option>
			<option value="soksokemotorer">Søk, søkemotorer, søkeord, annonsering, internett etc.</option>
			<option value="prradgivereprbyraer">PR-rådgivere, PR-byråer og PR-hjelp (PR-bransjen)</option>
			<option value="legemiddelkonsulenter">Legemiddelkonsulenter</option>
			</optgroup>
	</select>
</div>	
</form>				    </div>
				    <div class="second top-row">
					  <form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">PC-programmer - nettlesere - lagring etc.</option>
		<optgroup label="Diverse nettlesere (browsers), programmer etc.">
			<option value="nullctrl" class="addgray">Null CTRL - søker etter kjente feil på din IP-adresse (Dagbladet)</option>
			<option value="sikkerhetskopieringavepostmailstore">MailStore (sikkerhetskopiering av e-post og personlige filer)</option> 
			<option value="skanneportene">Du bør skanne portene dine - Mange mangler oversikt over hva de egentlig deler med alle på Internett (digi.no 25.10.2013)</option> 
			<option value="ibeenpwned">';--have i been pwned? (sjekk om ditt brukernavn/epostadresse er på listen fra kjente datainnbrudd)</option> 
			<option value="softperfect">SoftPerfect WiFi Guard - Keep your Wi-Fi network secure (softperfect.com)</option>
			<option value="enhancedmitigationexperience">Enhanced Mitigation Experience Toolkit 5.2 (Microsoft Download Center)</option> 
			<option value="windows_Update_troubleshoot" class="addgray">Windows Update Troubleshoot</option>
			<option value="avtest">AV-TEST GmbH (de beste antivirusprogrammene)</option> 
			<option value="testskrivehastigheten">Improve your Typing Speed (test skrivehastigheten)</option> 
			<option value="whatsmyiporg">Finn din ip-adresse - Whatsmyip.org</option>
			<option value="wirelessnetworkwatcher">Finn din MAC-adresse - Wireless Network Watcher (cnet.com)</option>
			<option value="googletriksene">Her er Google-triksene du bør kunne (dinside.no 21.8.2014)</option> 
			<option value="windows10tips">GUIDE: Slik installerer du Windows 10 Ønsker du å slette alt på harddisken og installere Windows fra bunnen av? Da kan du følge Dinsides installasjonsguide. (dinside.no 18.4.2016)</option> 
			<option value="snipping_pasting_previewing">3 Windows tools for snipping, pasting, and previewing. Windows includes a bunch of often-overlooked utilities that can boost your productivity. (cnet.com 20.4.2016)</option> 
			<option value="mobilvennlig_test">Mobilvennlig-test</option>
			<option value="mobile_friendly_websites">Welcome! | Mobile Friendly Websites | Google Developers</option> 
			<option value="responsive_web_design">Responsive Web Design</option> 
						<option value="lastesnettsidenetregt">Lastes nettsidene tregt? (dinside.no 26.8.2014)</option> 
			<option value="dingsenedinekanliggeaapnepaanett">Dingsene dine kan ligge åpne på nett (dinside 31.1.2014)</option> 
			<option value="usikkertno">Usikkert.no</option>
			<option value="blitthacket">Sikre tegn på at du er blitt hacket (dinside.no 29.7.2014)</option> 
			<option value="pcdecrapifier">PC Decrapifier (fjerner unødvendige programmer, verktøylinjer etc.)</option> 
			<option value="ibeenpwned">';--have i been pwned? (sjekk om ditt brukernavn/epostadresse er på listen fra kjente datainnbrudd)</option> 
			<option value="unchecksprograms">Unchecks (Installers often try to sneak additional programs as a natural part of the installation)</option>  
			<option value="falskenettsider">Falske nettsider</option> 
			<option value="sikkerhetnorsisno" class="addgray">Sikkerhetsverktøy (Norsis.no)</option>
			<option value="thehackernews">The Hacker News (THN)</option> 
			<option value="networkportscanner">speedguide.net - Network Port Scanner</option> 
			<option value="portscannergfi">Scan ports with minimal effort - using GFI LanGuard</option> 
			<option value="ccleaner" class="addgray">CCleaner (ccleaner.com) (Piriform)</option>
			<option value="revouninstaler">Revo Uninstaler Antivirus</option> 
			<option value="pandathecloud">Panda - The Cloud Security Company - Antivirus</option> 
			<option value="malwarebytesantimalware">Malwarebytes Anti-Malware (DETECTS AND DESTROYS)</option>
			<option value="hitmanpro">HitmanPro 3 - Second Opinion Malware Scanner </option>
			<option value="tweakingcom">Tweaking.com - Windows Repair (All in one)</option> 
			<option value="farbarrecoveryscantool">bleepingcomputer.com - Farbar Recovery Scan Tool Download</option> 
			<option value="mcafeebrukerstotte">McAfee brukerstøtte</option> 
			<option value="secunapersonalsecurityinspector" class="addgray">Secunia Personal Software Inspector (PSI)</option>
			<option value="malwarewinzip">Se etter ondsinnet programvare (malware) nå - WINZIP Malware Protector</option> 
			<option value="lyndacom">lynda.com</option> 
			<option value="microsoftsikkerhet">DATASIKKERHET (Microsoft)</option>
			<option value="tiskjultetips">Ti skjulte Windows-tips (dinside.no 9.4.2014)</option> 			
			<option value="accessibilityenablespeople">Accessibility enables people (Microsoft)</option>  
			<option value="safetycentermicrosoft">Malicious Software Removal Tool - Safety & Security center (Microsoft)</option> 
character "&" is the first character of a delimiter but occurred as data
Line: 2280, Col: 83
…alicious Software Removal Tool - Safety & Security center (Microsoft)</option>
			<option value="fixitsupportcentermicrosoft" class="addgray">Fixit support center (Finn automatiserte løsninger på problemene dine) (Microsoft)</option>
			<option value="tilleggmicrosoft">Behandle tillegg i Internet Explorer (Microsoft)</option> 
			<option value="asustradlosstasjonar">Asus PCE-AC68 - Trådløst nett kan også brukes i stasjonære PC-er (dinside.no 1.11.2013)</option> 
			<option value="testflare">TEST: Flare Magnetic - Slik blir iPad nesten til MacBook! (dinside.no 19.10.2013)</option> 
			<option value="ninitecom">Install and Update All Your Programs at Once (Ninite.com)</option>
			<option value="ustdeleteme">justdelete.me - A directory of direct links to delete your account from web services</option> 
			<option value="powerockssupermagicstick">TEST: Nødladeren Powerocks Super Magicstick< (dinside.no 3.10.2013)/option> 
character "<" is the first character of a delimiter but occurred as data
Line: 2287, Col: 88
…k">TEST: Nødladeren Powerocks Super Magicstick< (dinside.no 3.10.2013)/option>
			<option value="internetexplorer11" class="addgray">Internet Explorer, Office etc. (Microsoft Download Center)</option>
document type does not allow element "option" here
Line: 2288, Col: 54
…e="internetexplorer11" class="addgray">Internet Explorer, Office etc. (Microso…
			<option value="cookiesnettsider">Hvilke krav stilles for å bruke cookies på nettsider? Nytt lovforslag 1. mars klargjør kravene til cookies (hegnar.no 9.3.2013)</option> 
document type does not allow element "option" here
Line: 2289, Col: 36
<option value="cookiesnettsider">Hvilke krav stilles for å bruke cookies på …
			<option value="rengjorpctelenor">Rengjør PC-en – få bedre ytelse (telenor.no)</option>
document type does not allow element "option" here
Line: 2290, Col: 36
<option value="rengjorpctelenor">Rengjør PC-en – få bedre ytelse (telenor.no…
			<option value="koblepctilnett">Vil du koble PCen til TVen? (netonnet.no</option> 
document type does not allow element "option" here
Line: 2291, Col: 34
<option value="koblepctilnett">Vil du koble PCen til TVen? (netonnet.no</opt…
			<option value="norsisgratisonline" class="addgray">Fjerning av skadelig kode - Hvordan oppdager man ondsinnet programvare/kode (Norsis.no)</option>
document type does not allow element "option" here
Line: 2292, Col: 54
…e="norsisgratisonline" class="addgray">Fjerning av skadelig kode - Hvordan opp…
			<option value="windowsdefenderoffline">Windows Defender Offline</option> 
document type does not allow element "option" here
Line: 2293, Col: 42
<option value="windowsdefenderoffline">Windows Defender Offline</option>
			<option value="fixitsupportcentermicrosoft" class="addgray">Fixit support center (Finn automatiserte løsninger på problemene dine) (Microsoft)</option>
document type does not allow element "option" here
Line: 2294, Col: 63
…upportcentermicrosoft" class="addgray">Fixit support center (Finn automatisert…
			<option value="microsoftsecurityessentials">Micrsoft Kundestøtte - Løs et teknisk problem</option> 
document type does not allow element "option" here
Line: 2295, Col: 47
…on value="microsoftsecurityessentials">Micrsoft Kundestøtte - Løs et teknisk p…
			<option value="adobeflahnedlasting" class="addgray">Adobe - Lesere og spillere - Produktnedlastinger (Download Center)</option> 
document type does not allow element "option" here
Line: 2296, Col: 55
…="adobeflahnedlasting" class="addgray">Adobe - Lesere og spillere - Produktned…
			<option value="freejavadownload">Free Java Download</option> 
document type does not allow element "option" here
Line: 2297, Col: 36
<option value="freejavadownload">Free Java Download</option>
			<option value="verifyjava">Verify Java and Find Out-of-Date Versions</option> 
document type does not allow element "option" here
Line: 2298, Col: 30
<option value="verifyjava">Verify Java and Find Out-of-Date Versions</option…
			<option value="browsercheck" class="addgray">Browser Check (Start a browser check to identify any security issues in your browser)</option> 
document type does not allow element "option" here
Line: 2299, Col: 48
…n value="browsercheck" class="addgray">Browser Check (Start a browser check to…
			<option value="dnschangercheckup">DNS Changer Check-Up</option> 
document type does not allow element "option" here
Line: 2300, Col: 37
<option value="dnschangercheckup">DNS Changer Check-Up</option>
			<option value="filezilla" class="addgray">FileZilla, the free FTP solution</option> 
document type does not allow element "option" here
Line: 2301, Col: 45
…tion value="filezilla" class="addgray">FileZilla, the free FTP solution</optio…
			<option value="systemmechanic">Gjør datamaskinen raskere med System Mechanic (Dell.no)</option> 
document type does not allow element "option" here
Line: 2302, Col: 34
<option value="systemmechanic">Gjør datamaskinen raskere med System Mechanic…
			<option value="toolbarcleaner" class="addgray">Toolbar Cleaner (fjern uønskede verktøylinjer)</option>
document type does not allow element "option" here
Line: 2303, Col: 50
…value="toolbarcleaner" class="addgray">Toolbar Cleaner (fjern uønskede verktøy…
			<option value="multirframeasus">MultiFrame (ASUS)</option> 
document type does not allow element "option" here
Line: 2304, Col: 35
<option value="multirframeasus">MultiFrame (ASUS)</option>
			<option value="pdfpreview7">PDF Preview for Windows 7</option> 
document type does not allow element "option" here
Line: 2305, Col: 31
<option value="pdfpreview7">PDF Preview for Windows 7</option>
			<option value="techtracker">TechTracker (CNET)</option> 
document type does not allow element "option" here
Line: 2306, Col: 31
<option value="techtracker">TechTracker (CNET)</option>
			<option value="crashanalysistools">Crash Analysis Tools - WhoCrashed 2.00 ("blue screen")</option> 
document type does not allow element "option" here
Line: 2307, Col: 38
<option value="crashanalysistools">Crash Analysis Tools - WhoCrashed 2.00 ("…
			<option value="freepdfconverter">doPDF free PDF converter (lagre nettsider - you can freely convert documents to searchable PDF files from any Windows application)</option> 
document type does not allow element "option" here
Line: 2308, Col: 36
<option value="freepdfconverter">doPDF free PDF converter (lagre nettsider -…
			<option value="anybizsoft">AnyBizSoft PDF to Word Converter (PDF to Word etc.)</option> 
document type does not allow element "option" here
Line: 2309, Col: 30
<option value="anybizsoft">AnyBizSoft PDF to Word Converter (PDF to Word etc…
			<option value="foxitreader">Foxit Reader (foxitsoftware.com)</option> 
document type does not allow element "option" here
Line: 2310, Col: 31
<option value="foxitreader">Foxit Reader (foxitsoftware.com)</option>
			<option value="enpdfleser">Få en PDF-leser som er fri programvare! (pdfreaders.org)</option> 
document type does not allow element "option" here
Line: 2311, Col: 30
<option value="enpdfleser">Få en PDF-leser som er fri programvare! (pdfreade…
			<option value="freejavadownload">Free Java Download - Download Java for your desktop computer now!</option> 
document type does not allow element "option" here
Line: 2312, Col: 36
<option value="freejavadownload">Free Java Download - Download Java for your…
			<option value="unlocker">Unlocker - unable to delete a file in Windows, Unlocker is the solution</option>
document type does not allow element "option" here
Line: 2313, Col: 28
<option value="unlocker">Unlocker - unable to delete a file in Windows, Unlo…
			<option value="freeopener">FREEOPENER - Open Many File Types for FREE!</option>
document type does not allow element "option" here
Line: 2314, Col: 30
<option value="freeopener">FREEOPENER - Open Many File Types for FREE!</opti…
			<option value="driveridentifier">DRIVER INDENTIFIER DOWNLOAD (Find and Update Your Drivers instantly)</option> 
document type does not allow element "option" here
Line: 2315, Col: 36
<option value="driveridentifier">DRIVER INDENTIFIER DOWNLOAD (Find and Updat…
			<option value="keyboardcleantool">KeyboardCleanTool (It just blocks your keyboard input so you can wipe over your keyboard in order to clean it)</option> 
document type does not allow element "option" here
Line: 2316, Col: 37
<option value="keyboardcleantool">KeyboardCleanTool (It just blocks your key…
			<option value="digitvie68">digi TV: Microsoft om IE6 og IE8 del 1 av 5 (youtube.com 26.2.2009)</option> 
document type does not allow element "option" here
Line: 2317, Col: 30
<option value="digitvie68">digi TV: Microsoft om IE6 og IE8 del 1 av 5 (yout…
			<option value="skalfikse">Skal fikse store nettsteder med dårlig kode (9.12.2008)</option> 
document type does not allow element "option" here
Line: 2318, Col: 29
<option value="skalfikse">Skal fikse store nettsteder med dårlig kode (9.12.…
			<option value="opera">Opera (Opera Software ASA)</option>
document type does not allow element "option" here
Line: 2319, Col: 25
<option value="opera">Opera (Opera Software ASA)</option>
			<option value="firefox">Firefox (Mozilla Europe og Mozilla Foundation)</option>
document type does not allow element "option" here
Line: 2320, Col: 27
<option value="firefox">Firefox (Mozilla Europe og Mozilla Foundation)</opti…
			<option value="safari">Safari (Apple Inc.)</option>
document type does not allow element "option" here
Line: 2321, Col: 26
<option value="safari">Safari (Apple Inc.)</option>
			<option value="flock">Flock (Flock, Inc.)</option>
document type does not allow element "option" here
Line: 2322, Col: 25
<option value="flock">Flock (Flock, Inc.)</option>
			<option value="mostpopularinbrowsers">Most Popular in Browsers (CNET Download.com)</option>
document type does not allow element "option" here
Line: 2323, Col: 41
… <option value="mostpopularinbrowsers">Most Popular in Browsers (CNET Download…
			<option value="browserstatistics">Browser Statistics (w3schools.com)</option> 
document type does not allow element "option" here
Line: 2324, Col: 37
<option value="browserstatistics">Browser Statistics (w3schools.com)</option…
			<option value="bakgrunnsbilderintterfacelift">Bakgrunnsbilder (InterfaceLIFT - Free High-Resolution Widescreen Wallpaper)</option> 
document type does not allow element "option" here
Line: 2325, Col: 49
… value="bakgrunnsbilderintterfacelift">Bakgrunnsbilder (InterfaceLIFT - Free H…
			<option value="desktopearth">Desktop Earth (codefromthe70s.org)</option> 
document type does not allow element "option" here
Line: 2326, Col: 32
<option value="desktopearth">Desktop Earth (codefromthe70s.org)</option>
			<option value="nettleserefunksjonshemmede">Nettlesere spesielt laget for funksjonshemmede (inkluderer talestyrte nettlesere)</option>
document type does not allow element "option" here
Line: 2327, Col: 46
…ion value="nettleserefunksjonshemmede">Nettlesere spesielt laget for funksjons…
			<option value="rolltalkfalckigel">Rolltalk (FALCK IGEL) (Rolltalk brukes av mennesker med nedsatt taleevne eller motorikk)</option> 
document type does not allow element "option" here
Line: 2328, Col: 37
<option value="rolltalkfalckigel">Rolltalk (FALCK IGEL) (Rolltalk brukes av …
			<option value="medialt">MediaLT (MediaLT er et annerledes IT firma, som satser på teknologi rettet mot funksjonshemmede)</option> 
document type does not allow element "option" here
Line: 2329, Col: 27
<option value="medialt">MediaLT (MediaLT er et annerledes IT firma, som sats…
			<option value="lingspeak">LingSpeak (Er du lesesvak? LingSpeak leser teksten høyt for deg)</option> 
document type does not allow element "option" here
Line: 2330, Col: 29
<option value="lingspeak">LingSpeak (Er du lesesvak? LingSpeak leser teksten…
			<option value="cogain">COGAIN: Communication by Gaze Interaction (interface technologies for the benefit of users with disabilities)</option> 
document type does not allow element "option" here
Line: 2331, Col: 26
<option value="cogain">COGAIN: Communication by Gaze Interaction (interface …
			</optgroup>
end tag for "option" omitted, but OMITTAG NO was specified
Line: 2332, Col: 14
</optgroup>
		<optgroup label="PC - programmer som bl.a. fjerner søppel og øker ytelsen etc.">
			<option value="gratispcscanner">Få en gratis PC Sikkerhetsskanner - Microsoft</option>
			<option value="windowssteadystate">Windows SteadyState (Keep your shared access computers running smoothly with Windows SteadyState)</option> 
			<option value="microsoftmalwareprotectioncenter">Microsoft Malware Protection Center (Search the Encyclopedia)</option>
			<option value="secunapersonalsecurityinspector">Secunia Personal Software Inspector (PSI)</option> 
			<option value="filehippocomupdatechecker">FileHippo.com - Update Checker</option> 
			<option value="sjokktestav">Sjokktest av sikkerhetspakker (idg.no 14.10.2008)</option> 
			<option value="fsecureshealthcheck">F-secures HealthCheck (nettjeneste)</option> 
			<option value="nettjuvelendigi">Nettjuvelen (Gratisprogrammer og tjenester)</option> 
			<option value="kjentondsinnetprogramvarems">Kontroller om datamaskinen er infisert av kjent ondsinnet programvare (Microsoft® Windows® Malicious Software Removal Tool (KB890830))</option>
			<option value="registrymechanic">Registry Mechanic (PC Tools)</option> 
			<option value="advancedwindowscare">Advanced WindowsCare Personal users</option> 
			<option value="fsecureblacklightrootkit">F-Secure Blacklight Rootkit Eliminator</option> 
			<option value="falskesikkerhedsprogrammerccis">Falske sikkerhedsprogrammer er populære blandt it-kriminelle (CSIS Security Group)</option> 
			<option value="exelibrary">exeLibrary (exeLib is the fastest growing, most accurate, database of executable programs)</option> 
			<option value="defragmentereharddisken">Defragmentere harddisken for å forbedre ytelsen? - Microsoft</option>
			<option value="windowsdefender">Windows Defender</option>
			<option value="comodofirewall">Comodo Firewall Pro - Download</option> 
			<option value="testyouractivexinstallation">Test Your ActiveX Installation (pcpitstop.com)</option> 
			<option value="ondartetprogramkodenetvettno">"Ondartet programkode - slik beskytter du deg (Nettvett)</option> 
			<option value="automatiskoppdateringixpapple">Automatisk oppdatering - Microsoft - Apple (vg.no)</option>
			<option value="prevxcsi">Prevx Computer Security Investigator (CSI)</option> 
			<option value="fsecureonline">Scan Your Computer With the F-Secure Online Virus Scanner (FSECURE.COM)</option> 
			<option value="ramidlele">RAM Idle LE (TweakNow.com)</option>
			<option value="yougotasignal">YouGetSignal.com - Port Forwarding Tester (test om porter på din PC er lukket)</option> 
			<option value="glemtepassord">Slik finner du glemte passord (dinside.no 25.6.2008)</option> 
			<option value="siw">SIW - gir detaljert informasjon om din maskin og programvare (passord vises under "Secrets")</option>
			<option value="updatestar">UpdateStar (stay up-to-date with all of the personal software you are using on your computer)</option> 
			<option value="independentcomparativesofantivirus">Independent comparatives of Anti-Virus Software</option> 
			<option value="recuva">Recuva - gjenoppretter slettede filer - som uheldigbis er slettet fra PC (Gratis)</option>
			<option value="pcdecrapifier">PC Decrapifier (fjerner unødvendige programmer, verktøylinjer etc.)</option> 
			<option value="autorunsforwindows">AutoRuns for Windows (gir oversikt over hvilke programmer som starter opp samtidig som Windows)</option> 
			<option value="taskbarshuffle">Taskbar Shuffle (rearrange your taskbar buttons)</option> 
			<option value="ampwinoff">AMP WinOFF 4.21 (slå av PCen på et forhåndsvalgt tidspunkt)</option> 
			<option value="virusogspyware">Hjelp og støtte: Virus og Spyware (Elkjøp)</option>
			<option value="glemtpassordethererlosningen">Glemt passordet? Her er løsningen (dinside.no 8.10.2007)</option> 
			<option value="diversedatatips">Diverse datatips (mintankesmie.no)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Hvordan fjerne informasjons-kapsler (tracking cookies) fra nettleseren?">
			<option value="dataprotectioneuropeancommission">Data Protection (European Commission)</option> 
			<option value="optingoutdoubleclick">Opting Out (DoubleClick.com)</option> 
			<option value="optingoutomniture">Opting out (Omniture)</option> 
			<option value="fjerneinformasjonskapsler">Hvordan fjerner jeg informasjonskapslene mine? (Google.com)</option> 
			</optgroup>
		<optgroup label="Sikkerhetskopiering - kryptering - PC - online-lagring - lyd - mobil - klargjøring - sletting etc.">
			<option value="kruptos2">Kruptos 2 - Krypter viktige filer på PC, laptop, minnepinner etc. (dinside 11.3.2008)</option> 
			<option value="minnepinnepaavveie">Minnepinne på avveie</option> 
			<option value="neossafekey">Neo’s SafeKeys 2008 (a small program that helps to defeat keyloggers on unsecure computer terminals)</option> 
			<option value="nettlagringikketrygt">Nettlagring ikke trygt (digi.no 15.5.2009)</option> 
			<option value="digitaltidsbombe">Digital tidsbombe (aftenposten.no 2.5.2008)</option> 
			<option value="youtubedownloader">YouTube Downloader</option> 
			<option value="freecordertoolbar">Freecorder Toolbar - Free Sound Recorder (ta opp det du hører på PC-høytalerne)</option> 
			<option value="kickyoutube">KickYouTube: Enkleste måte å laste ned fra YouTube på (teknonytt.com 23.11.2008)</option> 
			<option value="roterbortsensitivinfo">- Roter bort sensitiv informasjon (nrk.no 7.4.2008)</option> 
			<option value="enkeloggratiskryptering">Enkel og gratis kryptering (dinside.no 1.8.2008</option> 
			<option value="backupify">Backupify (lagring av data på ulike nettjenester)</option> 
			<option value="windowsskydrive">Windows SkyDrive (Microsoft) - Lagre og gå til dine personlige filer uansett hvor du er på Internett (5 GB)</option> 
			<option value="sikkerhetskopieringavepost">Sikkerhetskopiering av e-post (Outlook)</option>
			<option value="sikkerhetskopieringavepostmailstore">MailStore (sikkerhetskopiering av e-post og personlige filer)</option> 
			<option value="seanimasjonsikkerhetskopieringindeks">Se animasjon om hvordan du sikkerhetskopierer (nettvett.no)</option> 
			<option value="sikkerhetskopier">Tar ikke sikkerhetskopier?</option>
			<option value="4share">4Share (5GB gratis online lagring)</option> 
			<option value="mozyonlinebackup">Mozy (2GB gratis online lagring)</option> 
			<option value="idrivebackup">IDrive offers (2GB gratis online lagring)</option> 
			<option value="mamutonlinebackup">Mamut Online Backup (jobber automatisk i bakgrunnen og sikkerhetskopierer dine filer i det øyeblikket de opprettes eller endres)</option> 
			<option value="gjorpcenklarforinternett">Gjør PC-en klar for Internet (NorSIS)</option>
			<option value="nysikkerslettingnorsis">Ny veiledning: Sikker sletting (NorSIS)</option>
			<option value="Sikkerhetskopieringnorsisno">Hva kan skje med lagret informasjon (NorSIS)</option>
			<option value="kantappepcen">Minnepinnen kan tappe PC-en din (tu.no 21.2.2008)</option> 
			<option value="ungatradlosfellene">Slik unngår du trådløs-fellene (vg.no 18.1.2008)</option> 
			</optgroup>
		<optgroup label="Diverse lagringsmuligheter etc.">
			<option value="velgriktigminnepinne">Velg riktig minnepinne (Teknofil)</option>
			<option value="sikrerduminnepinnen">Slik sikrer du minnepinnen (teknofil.no 6.9.2010)</option>
			<option value="minnepinnerprisjaktusb">Minnepinner USB (prisjakt) (PS! Sjekk lese- og skriveytelse)</option>
			<option value="livtilgamleharddisker">Nytt liv til gamle harddisker (bruk dine gamle harddisker) (dinside.no 24.7.2008)</option> 
			<option value="nyttlivtilharddisken">Nytt liv til harddisken (vg.no 31.8.2008)</option> 
			<option value="sharkoondrivelink">Sharkoon Drivelink (Hente / lagre på brukte harddisker - IDE og SATA) (dinside.no 8.1.2009)</option> 
			<option value="testlagringpanett">TEST: Lagring på nett (dinside.no 16.6.2009)</option> 
			<option value="sataquickport">SATA QuickPort (rask måte å koble til løse harddisker) (SATA HDD)</option> 
			<option value="drivebackup90express">Drive Backup 9.0 Express (Easy step to total PC safety. FREE!)</option> 
			<option value="microsoftsynctoy">Microsoft SyncToy (SyncToy: the smart way to copy files)</option> 
			<option value="sikrerduminnepinnen">Slik sikrer du minnepinnen (teknofil.no 6.9.2010)</option>
			<option value="tryggeminnepinner">Her ligger filene dine trygt (dinside.no 8.4.2008)</option> 
			<option value="kruptos2">Kruptos 2 - Krypter viktige filer på PC, laptop, minnepinner etc. (dinside 11.3.2008)</option> 
			<option value="dataslurping">Slurping av data (NorSIS)</option> 
			<option value="advarermotminnepinner">Advarer mot minnepinner (aftenposten.no 7.11.2008)</option> 
			<option value="roterbortsensitivinfo">- Roter bort sensitiv informasjon (nrk.no 7.4.2008)</option> 
			<option value="backupvodafone">Back-up av kontaktinformasjon mobiltelefoner - Vodafone360 (ZYB)</option> 
			<option value="elagringavpapir">E-lagring av papirer</option>
			<option value="edocsuk">e-Docs UK (e-lagring av papirer)</option>
			<option value="digitallagring">Dyrest å lagre digitalt (itavisen.no 28.12.2007)</option> 
			<option value="vinylipod">Vinyl rett i iPoden - Lagrer favorittplatene rett inn på den digitale musikkspilleren (forbruker.no 3.1.2008)</option> 
			<option value="healthvaultmicrosoft">HealthVault (Microsoft)</option> 
			<option value="mediamax">MediaMax (Get 25 GBs of FREE online storage - Best Online Storage on the Web)</option>
			<option value="googlefreeandpaidstorage">What Google services offer free and paid storage?</option>
			</optgroup>
		<optgroup label="Diverse scannere (for det papirløse kontor)">
			<option value="hpscanjetn7000">HP Scanjet 7000 Sheet-feed </option> 
			<option value="canonip50">Canon P-150 skanner</option> 
			<option value="hpscanjet7650">HP Scanjet 7650 dokumentplanskanner</option> 
			<option value="sheetfedscanner">Fujitsu - fi-6130 Sheet-Fed Scanner</option> 
			<option value="xeroxdocumate262">Xerox DocuMate 262</option>
			</optgroup>
		<optgroup label="Diverse skjermdumpere (captures - snapshots - screenshots)">
			<option value="picpick">PicPick Tools - All-in-one Design Tools</option> 
			<option value="screencaptureandimage">Screen Capture and Image Sharing Toolkit</option> 
			<option value="snagit">SnagIt (Take a “snapshot” of anything on your PC screen. Send it, store it, turn it into a detailed graphic, find it later)</option>
			</optgroup>
		<optgroup label="Google">
			<option value="newsfromgoogle">News from Google (Press Center)</option>
			<option value="productdescriptionsgoogle">Product Descriptions (Google Press Center)</option>
			<option value="googleguide">Google Guide (Making Searching Even Easier)</option>
			<option value="labsgooglecom">Labs.google.com (Google's technology playground)</option>
			<option value="hottrendsusa">Hot Trends (USA) (Google - Google Labs)</option>
			</optgroup>
		<optgroup label="Surf uten nettilgang (Offline surfing)">
			<option value="webaroo">Webaroo (carry your favorite web content on the device and access it from any computer)</option>
			<option value="surfutennettilgangdinside">Surf uten nettilgang (dinside.no 24.10.2006)</option>
			<option value="scrybemedogutennettilgang">Scrybe - kalenderen som fungerer både med og uten nettilgang (dinside.no 14.8.2007)</option>
			</optgroup>
		<optgroup label="PC - diverse">
			<option value="tabelloverhurtigtasterwiki">Tabell over hurtigtaster (Table of keyboard shortcuts) (wkipedia.org)</option> 
			<option value="altkoderspesialtegn">ALT-koder: Oversikt over spesialtegnene i Windows (korrekturavdelingen.no)</option> 
			<option value="capturewizpro">CaptureWizPro (Skjermdumper - Screensaver)</option> 
			<option value="faststonecapture">FastStone Capture (Skjermdumper - Screensaver - Video Files)</option> 
			<option value="dinegenpc">Få din egen sky-PC - PC for alle uten en PC (vg.no 8.4.2009)</option> 
			<option value="jpgpngorgif">JPG, PNG or GIF: How to Choose an Image Format for Screenshots (Digital Inspiration)</option> 
			<option value="omnidearulers">Rulers (allows to create on whole screen area a set of rulers, like most common graphic editors allows on their working areas only)</option> 
			<option value="jrscreenruler">JR Screen Ruler (allows you to accurately measure anything on your screen)</option> 
			<option value="adobelabcolour">Adobe Labs - Create (Adobe® kuler is a web-hosted application from Adobe Labs for generating color themes that can inspire any project)</option> 
			<option value="freewarepdfunlocker">Freeware PDF Unlocker (fjerner restriksjoner som hindrer bl.a. kopiering, redigering og utskrift av PDF-dokumenter)</option> 
			<option value="colourlovers">COLOURlovers™ (a resource that monitors and influences color trends)</option> 
			<option value="hexcolorfinder">Hex Color Finder (This is a color finder that allows you to (...) retrieve specific colors from any area on your screen)</option> 
			<option value="keybrcom">keybr.com (test hvor fort du skriver)</option> 
			<option value="tinyurl">TinyURL.com (- create a tiny URL)</option> 
			<option value="krympedenettadresser">Hva er krympede nettadresser? (norsis.no 27.7.2009)</option> 
			<option value="krympendenettadresser">Advarer mot krympede nettadresser (digi.no 8.7.2009)</option> 
			<option value="convertpdftoword">Convert PDF to Word (Convert PDF's to any application)</option> 
			<option value="syrsammenpdf">Slik syr du sammen PDF-dokumenter (dinside.no 25.3.2009)</option> 
			<option value="microsoftsynctoy">Microsoft SyncToy (SyncToy: the smart way to copy files)</option> 
			<option value="fornybegynneretradlostnettverk">For nybegynnere: Hvordan setter jeg opp trådløst nett? (dinside.no 3.2.2008)</option> 
			<option value="hpsmartwebprinting">HP Smart Web Printing (nedlasting av program - smarte webutskrifter)</option> 
			<option value="dlink">D-link (utstyr for å koble hjemme-PCene i nettverk etc.)</option> 
			<option value="prisguideskjermer24">Prisguide (Skjermer) (Hardware.no)</option> 
			<option value="gscreen">gScreen - The Dual Screen Laptop Company</option> 
			<option value="winsplitrevolution">WinSplit Revolution (allow you to separate your screen into two, three or four)</option>
			<option value="beggeskjermer">Få oppgavelinje på begge skjermer (dinside.no 7.11.2010)</option>
			<option value="icorevirtualaccounts">iCore Virtual Accounts - Genialt når flere deler samme PC. Hvorfor har ingen tenkt på det før? (dinside.no 8.11.2010)</option> 
			<option value="scandinaviankeyboard">Scandinavian Keyboard</option> 
			<option value="networkmagic">Network Magic ("All I want to do is connect to my wireless network")</option> 
			<option value="fjernstyrpcvianettleseren">Fjernstyr PCen gjennom nettleseren! (dinside.no)</option>
			<option value="logmein">LogMeIn Free gives you the flexibility to access and control your PCs or Macs from anywhere.</option> 
			<option value="forfalskningavavsenderadressernorsis">Forfalskning av avsenderadresser (NorSIS)</option> 
			<option value="webpageanalyzer">Web Page Analyzer (Best Web Site Speed Analyzers?)</option> 
			<option value="pingdomtools">Pingdom Tools (Best Web Site Speed Analyzers?)</option>
			<option value="superantispyware ">SUPERAntiSpyware</option> 
			<option value="howtogetrid">How to Get Rid of the Yahoo Toolbar - OpposingViews.com</option>
			<option value="resetwinsockinwindows7">Repair & Reset Winsock in Windows 7 (Windows7Themes.net)</option>
character "&" is the first character of a delimiter but occurred as data
Line: 2492, Col: 50
…value="resetwinsockinwindows7">Repair & Reset Winsock in Windows 7 (Windows7Th…
			<option value="freewindowregistryrepair">Free Window Registry Repair</option>
			<option value="adwcleaner">AdwCleaner</option>
			<option value="multiwaretips">MALWARETIPS.COM</option>
			<option value="fixyourbrowsercom">Fixyourbrowser.com/</option> 
			<option value="driverboosterfree">Driver Booster Free - The Most Effective and Easiest-to-use Driver Updater</option>
			<option value="filehippocomupdatechecker">FileHippo.com - Update Checker</option>
			<option value="defraggler">Defraggler (Piriform)</option> 
			<option value=" ">Tweaking.com - Windows Repair (All in one) (http://www.tweaking.com/files/setups/tweaking.com_windows_repair_aio_setup.exe)</option>
			<option value="rollback_rx">Rollback RX Home: Gjenopprett PC-en på sekunder (dinside.no 2.5.2016)</option>
			<option value="autohotkey">Autohotkey (Lag dine egne hurtigtaster - navn, forkortelser, funksjoner etc.)</option>
			</optgroup>
	</select>
</div>	
</form>
				    </div>
				    <div class="third top-row">
					  <form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">A til Å index (mintankesmie.no)</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="atilaa">A til Å index - temanyheter (mintankesmie.no)</option>
			<option value="atilaa1300">A til Å index (1-300) (mintankesmie.no)</option>
			</optgroup>
		<optgroup label="Reklame, journalisitikk, medieovervåkning, sponsing, juks, propaganda etc.">	
			<option value="medietilsynet">Medietilsynet</option>
			<option value="mediamediekritikk">Media (mediekritikk)</option>
			<option value="interessekonflikter">Interessekonflikter, bestikkelser og korrupsjon</option>
			<option value="reklame">Reklame, sponsing, journalistikk, spin og PR-virksomhet</option>
			<option value="profittjournalistikk">Profitt, journalistikk, juks, omdømme og propaganda</option>
			<option value="sponsingavjournalistikk">Sponsing av journalistikk</option>
			<option value="medieovervakning">Medieovervåkning, medieanalyse, monopol og tekstreklame</option>
			<option value="soksokemotorer">Søk, søkemotorer, søkeord, ann  onsering, internett etc.</option>
			</optgroup>
		<optgroup label="Generell informasjon">
			<option value="ytringsfrihet">Ytringsfrihet og offentlighet</option>
			<option value="maktogdemokratiutredningen">Makt og demokratiutredningen</option>
			<option value="etikkbutikk">Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter</option>
			<option value="klimamiljoogglobalisering">Klima, miljø og globalisering</option>
			<option value="soksokemotorer">Søk, søkemotorer, søkeord, annonsering, internett etc.</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			<option value="lobbyisme">Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon)</option>
			<option value="tankesmier">Tankesmier</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="offentligforvaltning">Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)</option>
			<option value="fysisktrening">Fysisk trening (aktivitet / løping / jogging)</option>
			<option value="arbeidsogvelferdsdirektoratet">NAV (Arbeids- og velferdsdirektoratet) (Arbeids- og velferdsetaten (tidligere Aetat og trygdeetaten))</option>
			<option value="eukommisjonen">EU-kommisjonen</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="diversedatatips">Diverse datatips (mintankesmie.no)</option>
			<option value="bivirkningersymptomer">Bivirkninger symptomer og sykdommer</option>
			<option value="ideutviklingkreativitet">Idéutvikling, kreativitet og gründervirksomhet</option>
			<option value="lykke">Lykke (Happiness)</option>
			<option value="sportogspill">Sport og spill (mintankesmie.no)</option>
			<option value="arbeidsmiljoogarbeidsrett">Arbeidsmiljø, yrkesskader og arbeidsrett (arbeidstilsynet)</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="diverseskadeerstatninger">Diverse skadeerstatninger (skadeserstatninger)</option>
			<option value="legersintegritet">Legers integritet, kompetanse og kvalitet</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="rulebynobody">Rule by nobody - ondskapens filosofi</option>
			<option value="gjeldsproblemer">Gjeldsproblemer, gjeldsoffer og løsninger</option>
			<option value="fattigdom">Fattigdom, fordelingspolitikk (bistand) og rikdom</option>
			<option value="bankbors">Bank, børs og finans</option>
			<option value="skattskattesvindel">Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)</option>
			<option value="okokrim">Økokrim (økonomisk kriminalitet / miljøkriminalitet)</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="politietetterforskning">Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)</option>
			<option value="diverseforbrukertips">Diverse forbrukertips (mintankesmie.no)</option>
			<option value="medisinskeordoguttrykk">Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)</option>
			<option value="vioxxhvemvisstehva">Vioxx - informasjon versus kunnskap og visdom - hvem visste hva?</option>
			<option value="avandiahvemvisstehva">Avandia (rosiglitazone) - informasjon versus kunnskap og visdom - hvem visste hva?</option>
			<option value="thalidomide">Thalidomide (Thalidomid) - informasjon versus kunnskap og visdom - hvem visste hva?</option>
			</optgroup>
		<optgroup label="Medisinsk informasjon">
			<option value="medisinskeordoguttrykk">Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)</option>
			<option value="engelsknorsk">Engelsk - norsk</option>
			<option value="wikileaks">WikiLeaks</option>
			<option value="medisinskevarslere">Varslere (medisinske varslere) (whistleblowers) etc.</option>
			<option value="tidsskrifteroguavhengighet">Medisinske tidsskrifter og uavhengighet</option>
			<option value="manglendeapenhetomlegersinteressekonflikter">Manglende åpenhet om legers interessekonflikter</option>			
			<option value="pengersinnflytelsepamedisinskforskning">Pengers innflytelse på medisinsk forskning</option>
			<option value="whoomlegemiddelforsok">WHO (Verdens helse-organisasjon) om legemiddelinformasjon og legemiddelforsøk</option>
			<option value="fritilgangtil">Fri tilgang til forskningsresultater? (forskningsdata)</option>
			<option value="informasjonversuskunnskapogmakt">Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)</option>
			</optgroup>
		<optgroup label="Forskning og utvikling">
			<option value="forskningogressurser">Forskning og ressurser</option>
			<option value="uredelighet">Uredelighet og fusk i medisinsk forskning</option>
			<option value="spokelse">Spøkelsesforfattere (ghostwriters), legemidler og forskning</option>
			<option value="skiftet">Skiftet fra akademiske til kommersielle legemiddelnettverkn</option>
			<option value="erleger">Er leger forskere?</option>
			<option value="apenheturedelighet">Legemiddelstudier, åpenhet, uredelighet og kvalitet</option>
			<option value="legemiddelstudierforskningsjuks">Legemiddelstudier, forfattere, medforfattere, forskningsjuks etc.</option>
			<option value="rek">Regionale komiteer for medisinsk forskningsetikk (REK)</option>
			<option value="legemiddelutprovninglmkontrollkrim">Legemiddelutprøvning, legemiddelkontroll og legemiddelkriminalitet</option> 
			<option value="utenforpreparatomtale">Forskrivning utenfor preparatomtale ("off label") (utenfor indikasjon)</option>
			</optgroup>
		<optgroup label="Firmasponset produktinformasjon">
			<option value="sponsingavjournalistikk">Sponsing av journalistikk</option>
			<option value="pasientforeninger">Pasientforeninger (legemiddelfirmasponset helseinformasjon)</option>
			<option value="legenettsteder">Legenettsteder (legemiddelfirmasponset helseinformasjon)</option>
			<option value="dagensmedisin">Dagens Medisin, NHI.no (Norsk Helseinformatikk) (Medicinsktidsskrift.dk) (annonsesponset helseinformasjon - Bonnier)</option>
			<option value="norskfarmaceutisktidsskriftnft">Norsk Farmaceutisk Tidsskrift (NFT) (legemiddelfirmasponset helseinformasjon)</option>
			<option value="veldedighetsdonasjonerlegemiddelindustrien">Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)</option>
			<option value="legemiddelreklame">Legemiddelreklame (legemiddelinformasjon)</option>
			<option value="legemiddelinformasjon">Legemiddelinformasjon</option>
			<option value="legemiddelkonsulenter">Legemiddelkonsulenter</option>
			<option value="skiftet">Skiftet fra akademiske til kommersielle legemiddelnettverkn</option>
			<option value="salgavsykdom">Salg av sykdom</option>
			<option value="legemiddelindustrien">Legemiddelindustrien (Big Pharma)</option>
			<option value="legemiddelindustriforeninger">Legemiddelindustriforeninger</option>
			<option value="lobbyisme">Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon)</option>
			<option value="tankesmier">Tankesmier</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			</optgroup>
		<optgroup label="Opphavsrett, ytringsfrihet, undersøkende journalistikk etc.">	
			<option value="opphavsrett">Opphavsrett (copyright) og Fair Use</option>
			<option value="ytringsfrihet">Ytringsfrihet og offentlighet</option>
			<option value="frittord">Institusjonen Fritt Ord</option>
			<option value="pfu">PFU - Pressens Faglige Utvalg</option>
			<option value="skup">SKUP er etablert for å fremme den kritiske og undersøkende journalistikken i Norge</option>
			<option value="theopensocietyinstituteosi">The Open Society Institute (OSI) (George Soros)</option>
			<option value="propublica">ProPublica (Journalism in the Public Interest)</option>
			<option value="publiccitizen">Public Citizen</option>
			<option value="undersokende">Undersøkende (gravende) journalistikk</option>
			<option value="sponsingavjournalistikk">Sponsing av journalistikk</option>
			</optgroup>
		<optgroup label="Språk, utdanning, dekonstruksjon, informasjon og kunnskap (know-do gap)">				
			<option value="cuibono">Cui bono?</option>
			<option value="knowdogap">Know-do gap</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="sivilsaker">Sivilsaker</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="utleggtvangsinndrivelse">Utlegg (tvangsinndrivelse av pengekrav)</option>
			<option value="prosedyre">Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)</option>
			<option value="Justismord">Justismord (og rettssikkerhet)</option>
			<option value="synespolitikernelagetdarliglovcui">- Elendig rettssikkerhet for fattige (aftenposten.no 20.8.2007)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="loverlovdata">Lover (lovdata.no) og rettssikkerhet</option>
			<option value="klagepadommere">Klage på dommere, løgn, sakkyndighet osv.</option>
			<option value="klagepaadvokat">Klage på advokat - Hva kan man klage over? (Den Norske Advokatforening)</option>
			<option value="rulebynobody">Rule by nobody - ondskapens filosofi</option>
			<option value="skrivekunst">Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap</option>
			<option value="sprak">Språk, språkforståelse og utdanning</option>
			<option value="engelsknorsk">Engelsk - norsk</option>
			<option value="medisinskeordoguttrykk">Medisinske ord og uttrykk – forklaringer og oversettelser etc.</option>
			<option value="bibliotekerabm">Biblioteker ABM-utvikling (Statens senter for arkiv, bibliotek og museum)</option>
			</optgroup>
		<optgroup label="Gaver, smøring, gratis lunch, interessekonflikter, habilitet, varslere, korrupsjon etc.">	
			<option value="gaver">Gaver, smøring (gave gitt som bestikkelse) etc.</option>
			<option value="gratislunch">Gratis lunch, legemidler, grådighetskultur og korrupsjon</option>
			<option value="interessekonflikter">Interessekonflikter, bestikkelser og korrupsjon</option>
			<option value="habilitet">Habilitet (integritet)</option>
			</optgroup>
		<optgroup label="Firmasponsede rapporter, lobbyisme, tankesmier, PR-rådgivere, PR-byråer og PR-hjelp">	
			<option value="econ">Econ Pöyry</option>
			<option value="pharmecon">PharmEcon AS- Legemiddeløkonomisk Kompetanse</option>
			<option value="imshealth">IMS Health</option>
			<option value="lobbyisme">Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon)</option>
			<option value="tankesmier">Tankesmier</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			<option value="veldedighetsdonasjonerlegemiddelindustrien">Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="prradgivereprbyraer">PR-rådgivere, PR-byråer og PR-hjelp (PR-bransjen)</option>
			<option value="sponsingavjournalistikk">Sponsing av journalistikk</option>
			</optgroup>
		<optgroup label="Leger, sykepleiere, tannleger, legemidler og pasientsikkerhet">
			<option value="legerminfastlege">Leger (MinFastlege)</option>
			<option value="kommunikasjonmellomlege">Kommunikasjon mellom lege og pasient</option>
			<option value="pasientjournalerogepikriser">Pasientjournaler og epikriser</option>
			<option value="feilmedisineringerogfeilbehandlinger">Feilmedisineringer og feilbehandlinger (medisinske feil)</option>
			<option value="diagnostisering">Diagnostisering, feildiagnostisering, overdiagnostisering og pasientsikkerhet</option>
			<option value="pasientsikkerhet">Pasientsikkerhet (rettssikkerhet)</option>
			<option value="hygiene">Hygiene (smittsomme sykdommer / infeksjoner / smittevern)</option>
			<option value="prestisjesykdommer">Prestisjesykdommer (sykdommers prestisje / sykdommers rangering)</option>
			<option value="legersintegritet">Legers integritet, kompetanse og kvalitet</option>
			<option value="borlegerogsykehus">Bør leger og sykehus dokumentere sin etikk og praksis?</option>
			<option value="telemedisinroboteretc">Telemedisin, roboter etc. (e-helse)</option>
			<option value="sykepleiere">Sykepleiere</option>
			<option value="tannleger">Tannleger og tannhelse (munnhulen er kroppens speil)</option>
			<option value="straffedomte">Straffedømte i helsevesenet (straffesaker) (straffesaker)</option>
			</optgroup>
		<optgroup label="Risikovurdering av informasjon og resultater">
			<option value="produktogtjene">Produkt- og tjenesteanalyse</option>
			<option value="screeningavblodprover">Screening (masseundersøkelse) av blodprøver etc.</option>
			<option value="risikoversus">Risiko-versus-kostnad-nytte-verdi (risiko versus nytteverdi)</option>
			<option value="fortolkemedisinskartikkel">Hvordan lese/fortolke en medisinsk artikkel</option>
			<option value="fortolkestatistiske">Hvordan lese/fortolke studieresultater (statistiske resultater)</option>
			<option value="skremselspropaganda">Skremselspropaganda</option>
			</optgroup>
		<optgroup label="Offentlig forvaltning, kontroll og rettigheter">
			<option value="offentligforvaltning">Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="hod">Helse- og omsorgsdepartementet (HOD)</option>
			<option value="shdir">Helsedirektoratet (tidligere Sosial- og helsedirektoratet (SHdir))</option>
			<option value="arbeidsogvelferdsdirektoratet">NAV (Arbeids- og velferdsdirektoratet) (Arbeids- og velferdsetaten (tidligere Aetat og trygdeetaten))</option>
			<option value="dep">Departementene og underliggende etaters krisehåndtering</option>
			<option value="helseforetakene">De regionale helseforetakene</option>
			<option value="sht">Statens helsetilsyn (Helsetilsynet) (SHT)</option>
			<option value="mattilsynet">Statens mattilsyn (Mattilsynet)</option>
			<option value="fylkeslegen">Fylkeslegen – Helsetilsynet (Statens helsetilsyn) - Fylkesmannen - Fylkesnemndene for barnevern og sosiale saker</option>
			<option value="pasientombudet">Pasient- og brukerombudet (Pobo) (pasientombudet)</option>
			<option value="sivilombudsmannen">Sivilombudsmannen (SOM)</option>
			<option value="eukommisjonen">EU-kommisjonen</option>
			<option value="who">WHO (World Health Organization)</option>
			<option value="menneskerettigheter">Menneskerettigheter (Den europeiske menneskerettighetsdomstolen (EMD) i Strasbourg)</option>
			</optgroup>
		<optgroup label="Skader, dødsfall, registre, statistikk og kostnader">	
			<option value="sykehusforvaltning">Sykehus, forvaltning, skader, dødstall og kvalitet</option>
			<option value="helsekostnaderforskning">Helsekostnader, forsikringer, forskning og budsjetter</option>
			<option value="statistikkoghelseregistre">Statistikk og helseregistre (helsedata)</option>
			<option value="medisinskfodselsregister">Medisinsk fødselsregister</option>
			<option value="kreftregisteret">Kreftregisteret</option>
			<option value="kreft">Kreft</option>
			<option value="legerdodstall">Leger, dødstall og kvalitet</option>
			</optgroup>
		<optgroup label="Statlig legemiddelkontroll, legemiddelsikkerhet og økonomi">				
			<option value="legemiddelokonomibivirkninger">Legemiddeløkonomi, bivirkninger og legemiddelomsetning</option>
			<option value="legemiddelreturkassasjon">Legemiddelretur (kassasjon) (Legemidler er farlig avfall)</option>
			<option value="miljooglegemiddel">Miljø og legemiddel</option>
			<option value="legemiddelogannensubstansavhengighet">Legemiddelavhengighet og annen substansavhengighet</option>
			<option value="statliglegemiddelkontroll">Statlig legemiddelkontroll (Statens legemiddelverk)</option>
			<option value="kunnskapssenteret">Kunnskapssenteret (Nasjonalt kunnskapssenter for helsetjenesten)</option>
			<option value="bivirkningerogbivirkningsovervakning">Bivirkninger og bivirkningsovervåkning</option>
			<option value="statligbivirkningsovervakning">Statlig bivirkningsovervåkning</option>
			<option value="pakningsvedleggmintankesmie">Legemiddel - pakningsvedlegg (legemiddelinformasjon)</option>
			<option value="preparatomtaler">Legemiddel - preparatomtaler (SPC) og pakningsvedlegg</option>
			<option value="diverselegemiddelkontrollorganer">Diverse kontrollorganer (enheter) for legemidler</option>
			<option value="emaemea">The European Medicines Agency (EMA) (tidligere EMEA) (den europeiske legemiddelkontrollen)</option>
			<option value="patenter">Patenter (varemerker)</option>
			<option value="generiskelegemidler">Generiske legemidler (generika) (kopimedisiner)</option>
			</optgroup>
		<optgroup label="Legemiddel-, tobakk-, matvare-, våpen- og kosmetikkindustrien">	
			<option value="legemiddelindustrien">Legemiddelindustrien (Big Pharma)</option>
			<option value="legemiddelindustriforeninger">Legemiddelindustriforeninger</option>
			<option value="matvareindustrienhelsekostversusjunkfood">Matvareindustrien (helsekost versus junk food) (Big Food)</option>
			<option value="alternativbehandling">Alternativ behandling (alternativ medisin)</option>
			<option value="sukkerindustrien">Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)</option>
end tag for element "a" which is not open
Line: 2736, Col: 68
…industrien">Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)</option>
			<option value="kosmetikkindustrien">Kosmetikkindustrien</option>
			<option value="tobakksindustrien">Tobakksindustrien (Big Tobacco)</option>
			<option value="vapenindustrien">Våpenindustrien</option>
			</optgroup>
		<optgroup label="Legemiddelforskrivning, feilmedisinering, feilbehandlinger og bivirkninger">	
			<option value="feilmedisineringerogfeilbehandlinger">Feilmedisineringer og feilbehandlinger (medisinske feil)</option>
			<option value="diagnostisering">Diagnostisering, feildiagnostisering, overdiagnostisering og pasientsikkerhet</option>
			<option value="bivirkningerogbivirkningsovervakning">Bivirkninger og bivirkningsovervåkning</option>
			<option value="retningslinjerogveiledere">Retningslinjer og veiledere</option>
			<option value="legemiddelforskrivning">Legemiddelforskrivning (feilforskrivning, overmedisinering, deforskrivning (seponering) </option>
			<option value="apoteker">Apoteker (apotekforeninger)</option>
			<option value="legemiddelnavnsomarsak">Legemiddelnavn som årsak til feilmedisinering</option>
			<option value="bivirkningersymptomer">Bivirkninger symptomer og sykdommer</option>
			<option value="bivirkningerorganskader">Bivirkninger (legemiddelinduserte organskader og sykdommer)</option>
			<option value="fosterskader">Fosterskader (legemiddelinduserte)</option>
			<option value="legemiddelindusertkreftogandretypercelleskader">Legemiddelindusert kreft og andre typer celleskader</option>
			<option value="computertomografictmagnetisk">Computertomografi (CT), magnetisk resonanstomografi (MR), positronemisjonstomografi (PET), ultrasonografi (ultralyd), kontrastmidler etc.</option>
			<option value="medisinskutstyr">Medisinsk utstyr</option>
			</optgroup>
		<optgroup label="Sykdommer, levealder og dødsårsaker">	
			<option value="sykelighetuforhet">Sykelighet, sykefravær, uførhet og trygd</option>
			<option value="dodstall">Dødstall, dødsattester og dødsstatistikk</option>
			<option value="levealderogdodsorsaker">Levealder og dødsårsaker</option>
			<option value="obduksjonerdodstall">Obduksjoner, dødstsall og dødsårsaker</option>
			<option value="organdonasjonerogtransplantasjoner">Organdonasjoner og transplantasjoner</option>
			<option value="barnevern">Barnevern, omsorgssvikt, barnemishandling og barnedrap</option>
			</optgroup>
		<optgroup label="Idéutvikling, kreativitet, gründervirksomhet etc.">	
			<option value="ideutviklingkreativitet">Idéutvikling, kreativitet og gründervirksomhet</option>
			<option value="innovasjon">Innovasjon</option>
			<option value="patenter">Patenter (varemerker)</option>
			<option value="lykke">Lykke (Happiness)</option>
			<option value="tidtime">Tid (Time)</option>
			</optgroup>
		<optgroup label="Bank, børs, forsikring, skatt og finans">	
			<option value="bankbors">Bank, børs og finans</option>
			<option value="meglere">Meglere (eiendommer, aksjer...)</option>
			<option value="forsikring">Forsikring</option>
			<option value="skattskattesvindel">Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)</option>
			</optgroup>
		<optgroup label="Gjeldsproblemer, fattigdom, miljø og globalisering">				
			<option value="gjeldsproblemer">Gjeldsproblemer, gjeldsoffer og løsninger</option>
			<option value="fattigdom">Fattigdom, fordelingspolitikk (bistand) og rikdom</option>
			<option value="arbeidsmiljoogarbeidsrett">Arbeidsmiljø, yrkesskader og arbeidsrett (arbeidstilsynet)</option>
			<option value="miljooghelse">Miljøog helse</option>
			<option value="miljooglegemiddel">Miljø og legemiddel</option>
			<option value="klimamiljoogglobalisering">Klima, miljø og globalisering</option>
			</optgroup>
		<optgroup label="Makt og demokrati">				
			<option value="maktogdemokratiutredningen">Makt og demokratiutredningen</option>
			<option value="lobbyisme">Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon)</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			<option value="ledelse">Ledelse, lederlønninger, pensjoner  etc.</option>
			<option value="etikkbutikk">Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter</option>
			<option value="informasjonversuskunnskapogmakt">Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)</option>
			<option value="hvemlyver">Hvem lyver om Irak?</option>
			</optgroup>
		<optgroup label="Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)">				
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="rulebynobody">Ondskapens filosofi (“rule by nobody”)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			</optgroup>
		<optgroup label="Lover og forskrifter">				
			<option value="loverlovdata">Lover (lovdata.no) og rettssikkerhet</option>
			<option value="rettpasak">Domstolmagasinet Rett på sak (domstol.no)</option>
			<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="advokatbladetsomebladher">Les Advokatbladet som eblad/PDF her (jus.no)</option>
			<option value="advokatbladetopplag">Advokatbladet (opplag)</option> 
			<option value="rettpasak">Domstolmagasinet Rett på sak (domstol.no)</option>
			<option value="juridiskordlistedomstol">Juridisk ordliste (Domstol.no)</option>
			<option value="retstidendeabonnement">Norsk retstidende (Abonnement - Advokatforeningen)</option>
			<option value="retstidende">Norsk retstidende (Tilgjengelig - ABM - Statens senter for arkiv, bibliotek og museum)</option>
			<option value="lovogrettpånett">Lov og rett på nett (Surfing på det juridiske hav)</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			</optgroup>
		<optgroup label="Konfliktsløsning">				
			<option value="konfliktradet">Konfliktrådet</option>
			<option value="forliksradeneforliksklager">Forliksrådene, forliksklager, Innkassoklagenemnda, Brukerklagenemnda, og Post- og teletilsynet (PT)</option>
			</optgroup>
		<optgroup label="Anmeldelser, påtale, håndhevelse, etterforskning osv.">				
			<option value="politietetterforskning">Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)</option>
			<option value="okokrim">Økokrim (økonomisk kriminalitet / miljøkriminalitet)</option>
			<option value="kripos">Kripos</option>
			<option value="politietssikkerhetstjeneste">Politiets sikkerhetstjeneste (PST)</option>
			<option value="riksadvokaten">Riksadvokaten - Statsadvokatene (Den høyere påtalemyndighet)</option>
			<option value="regjeringsadvokaten">Regjeringsadvokaten (statens advokatkontor i sivile saker)</option>
			<option value="finanstilsynet">Finanstilsynet (tidligere Kredittilsynet)</option>
			<option value="riksrevisjonen">Riksrevisjonen</option>
			<option value="havarikommisjoner">Havarikommisjoner (undersøkelseskommisjoner)</option>
			<option value="konkurransetilsynet">Konkurransetilsynet</option>
			<option value="stiftelsestilsynet">Stiftelsestilsynet (Lotteri- og stiftelsestilsynet)</option>
			</optgroup>
		<optgroup label="Rettssakers forløp">
			<option value="soksmol">Søksmål</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="prosedyre">Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="anke">Anke</option>
			</optgroup>
		<optgroup label="Manglende rettssikkerhet innen rettsvesenet">
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="amerikansketilstander">Amerikanske tilstander</option>
			<option value="gruppesoksmol">Gruppesøksmål</option>
			<option value="utleggtvangsinndrivelse">Utlegg (tvangsinndrivelse av pengekrav)</option>
			<option value="gjeldsproblemer">Gjeldsproblemer og løsninger</option>
			</optgroup>
		<optgroup label="Manglende kvalitet innen rettsvesenet">				
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="lydbandopptakvedpolitiavhorogiretten">Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) </option>
			<option value="klagepadommere">Klage på dommere, løgn, sakkyndighet osv.</option>
			</optgroup>
		<optgroup label="Sivilsaker">				
			<option value="sivilsaker">Sivilsaker</option>
			<option value="lydbandopptakvedpolitiavhorogiretten">Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) </option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="gjeldsproblemer">Gjeldsproblemer og løsninger</option>
			</optgroup>
		<optgroup label="Straffesaker (fengselsstraff)">				
			<option value="straffesaker">Straffesaker (fengselsstraff)</option>
			<option value="lydbandopptakvedpolitiavhorogiretten">Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) </option>
			<option value="denrettsmedisinskekommisjon">Den rettsmedisinske kommisjon (DRK)</option>
			<option value="kommisjonenforgjenopptakelse">Kommisjonen for gjenopptakelse av straffesaker (Justismordkommisjonen)</option>
			<option value="benadninger">Benådning av forbrytere (søknader om benådning)</option>
			</optgroup>
		<optgroup label="Diverse typer erstatningsordninger">	
			<option value="legemiddelerstatninger">Legemiddelerstatninger (søksmål)</option>
			<option value="npe">Norsk Pasientskadeerstatning (NPE)</option>
			<option value="diverseskadeerstatninger">Diverse skadeerstatninger (skadeserstatninger)</option>
			<option value="voldsoffererstatning">Voldsoffererstatning (vold)</option>
			<option value="billighetserstatning">Rettferdsvederlag (Stortingets rettferdsvederlagsordning) (tidligere billighetserstatning)</option>
			<option value="rettferdfortaperne">Stiftelsen Rettferd for taperne</option>
			<option value="farskapstester">Farskapstester (farskapssaker)</option>
			</optgroup>
		<optgroup label="Diverse legemidler, behandlinger, bivirkninger, symptomer etc.">	
			<option value="accutane">Accutane</option>
			<option value="adhd">ADHD</option>
			<option value="alkohol">Alkohol (Big Alcohol)</option>
			<option value="allergi">Allergi (allergier)</option>
			<option value="alzheimer">Alzheimer og andre årsaker til demens</option>
			<option value="ambulansetjenester">Ambulansetjenester</option>
			<option value="angrepillerabort">Angrepiller, abort etc.</option>
			<option value="antibiotika">Antibiotika (tarmbakterier, probiotika, mikrobiota etc.) (Dysbiose; dysbiosis (also called dysbacteriosis (dysbakteriose))</option>
			<option value="antidepressivadeprimertellerstresset">Antidepressiva - deprimert, litt trist, angst, stresset eller utbrent?</option>
			<option value="antidepressivatermostat">Antidepressiva (forhøyet kroppstemperatur)</option>
			<option value="antidepressivanytteverdi">Antidepressiva (nytteverdi)</option>
			<option value="antidepressivaremsovn">Antidepressiva (REM-søvn)</option>
			<option value="antidepressivasoksmal">Antidepressiva - søksmål</option>
			<option value="antidepressivassri">Antidepressiva (SSRI)</option>
			<option value="antidepressivazimelidine">Antidepressiva - zimelidine (Zelmid) (SSRI)</option>
			<option value="oyesykdommer">Antidepressiva (øyesykdommer)</option>
			<option value="antidepressivassriselvmord">Antidepressiva (SSRI-selvmord)</option>
			<option value="rusforgiftningeroverdoserogselvmord">Rus, forgiftninger, overdoser og selvmord</option>
			<option value="antidepressivalognpisspreikellersannhettom">Antidepressiva Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="serotoninihjerneogblod">- Serotonin i hjerne og blod</option>
			<option value="serotoninsyndromkramper">- Serotonin syndrom (SS), kramper, parkinsonisme osv. (forhøyet kroppstemperatur)</option>
			<option value="antipsykotika">Antipsykotika (psykofarmaka etc.)</option>
			<option value="medutviklingshemming">Diskriminering, feilmedisineringer hos mennesker med utviklingshemming og utfordrende atferd (psykofarmaka; antidepressiva, antipsykotika, sovemedisiner) etc.</option>
			<option value="aricept">Aricept (donepezil)</option>
			<option value="astmalegemidler">Astmalegemidler</option>
			<option value="benskjorhet">Benskjørhet (osteoporose)</option>
			<option value="blodtrykkslegemidler">Blodtrykkslegemidler</option>
			<option value="boneloc">Bone-loc</option>
			<option value="celebracelebrex">Celebra (Celebrex)</option>
			<option value="cipralex">Cipralex (Lexapro) (escitalopram) - Cipramil (Celexa) (cipramil) (citalopram) - H. Lundbeck A/S</option>
			<option value="cymbalta">Cymbalta (duloxetine hydrochloride)</option>
			<option value="diabetes">Diabetes</option>
			<option value="doping">Doping</option>
			<option value="ecstasy">Ecstasy (MDMA - 3,4-methylenedioxymethamphetamine)</option>
			<option value="efexor">Efexor / Effexor (venlafaxine) - Pristiq (desvenlafaxine)</option>
			<option value="elektrosjokk">Elektrosjokkbehandling (ECT), elektrosjokk, transkranial likestrømsstimulering (tDCS) etc.</option>
			<option value="epilepsilegemidler">Epilepsi og legemidler</option>
			<option value="eprex">Eprex (epoetin)</option>
			<option value="glukosamin">Glukosamin (giktmedisin)</option>
			<option value="heroin">Heroin (diacetylmorphine)</option>
			<option value="hivaids">HIV/AIDS</option>
			<option value="hjernen">Hjernen</option>
			<option value="hodepine">Hodepine</option>
			<option value="hormonterapi">Hormonterapi (HRT-behandling) (Hormon Replacement Therapy)</option>
			<option value="hostemedisiner">Hostemedisiner</option>
			<option value="hypothyreoseogandre">Hypo- og hyperthyreose, tyrotoksikose og andre thyreoideasykdommer</option>
			<option value="influensavaksiner">Influensavaksiner</option>
			<option value="ketek">Ketek (telithromycin)</option>
			<option value="kreft">Kreft</option>
			<option value="kronisktretthetssyndrom">Kronisk tretthetssyndrom/myalgisk encefalopati (CFS/ME)</option>
			<option value="kvikksolvforgiftninger">Kvikksølvforgiftninger (kvikksølv-saken - tannlegeassistenter)</option>
			<option value="litium">Litium (Lithium)</option>
			<option value="marihuana">Cannabis (marihuana hasj, pot etc.) (Big Marijuana)</option>
			<option value="metadon">Metadon (methadone hydrochloride) - Subotex (buprenorfin) (Buprenorphine)</option>
			<option value="migrenemedisin">Migrene (legemidler)</option>
			<option value="mitochondria">Mitochondria (mitokondrie) (mitokondriesykdommer) (mitokondrielle sykdommer)</option>
			<option value="nanoteknologi">Nanoteknologi (nanopartikler)</option>
			<option value="neurontin">Neurontin (gabapentin)</option>
			<option value="otrivin">Otrivin (xylometazoline hydrochloride) (nesedråper og nesespray)</option>
			<option value="oxycontin">OxyContin (oxycodone hydrochloride) (Oksykodon)</option>
			<option value="paracetamol">Paracetamol (acetaminophen) og diverse andre smertestillende midler</option>
			<option value="parkinsonlegemidler">Parkinsonlegemidler (Parkinsons sykdom)</option>
			<option value="ppiller">P-piller</option>
			<option value="plavix">Plavix (clopidogrel bisulfate)</option>
			<option value="protonpumpehemmere">Protonpumpehemmer (proton pump inhibitors (PPIs))</option>
			<option value="prozac)">Prozac (fluoxetine)</option>
			<option value="redux">Redux (dexfenfluramine)</option>
			<option value="remicade">TNF-alfa-hemmere (Remicade (infliximab/infliksimab), Humira (adalimumab), Enbrel (etanercept) etc.)</option>
			<option value="risperdal">Risperdal (risperidone)</option>			
			<option value="selvmord">Selvmord</option>
			<option value="seroxatssri">Seroxat (Paxil) (paroxetine; paroksetin) (SSRI)</option>
			<option value="serotoninihjerneogblod">Serotonin i hjerne og blod</option>
			<option value="serotoninsyndromkramper">Serotonin syndrom (SS), kramper, parkinsonisme osv. (forhøyet kroppstemperatur)</option>
			<option value="sifrol">Sifrol (pramipexol)</option>
			<option value="smon">SMON (oxikinolin)</option>
			<option value="somadril">Somadril (karisoprodol) (<strong>CARISOPRODOL</strong>)</option>
document type does not allow element "strong" here
Line: 2952, Col: 61
…lue="somadril">Somadril (karisoprodol) (<strong>CARISOPRODOL</strong>)</option>
			<option value="sovemidlerogberoligende">Sovemidler (sovemedisiner) og beroligende midler</option>
			<option value="sovn">Søvn</option>
			<option value="spilleavhengighet">Spilleavhengighet (spilleavhengige/problemspillere)</option>			
			<option value="statinerkolesterol">Statiner (mot høyt kolesterol)</option>
			<option value="tamifluinfluensavaksiner">Tamiflu (oseltamivir), Relenza (zanamivir) etc. (influensabehandling)</option>
			<option value="thalidomide">Thalidomide (Thalidomid) informasjon vs kunnskap og visdom - hvem visste hva?</option>
			<option value="trafikkulykker">Trafikk (trafikkulykker) (Veg- og trafikkinformasjon etc.)</option>
			<option value="trasylol">Trasylol</option>
			<option value="vaksiner">Vaksiner</option>
			<option value="vioxxhvemvisstehva">Vioxx - informasjon versus kunnskap og visdom - hvem visste hva?</option>
			<option value="vioxxogandresmertestillende">Vioxx (rofecoxib COX-2) og andre smertestillende</option>
			<option value="vioxxhistorienbak">Vioxx (historien bak)</option>
			<option value="xanor">Xanor (Xanax i USA) (alprazolam)</option>
			<option value="xenical">Xenical (orlistat) ("Alli")</option>
			<option value="zyprexa">Zyprexa</option>
			<option value="oynerersjelens">Øyesykdommer (øyner er sjelens vindu)</option>
			</optgroup>
	</select>
</div>	
</form>
				    </div>
				    <div class="first">
					  <form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">- Vitenskap eller intuisjon?</option>
		<optgroup label="Teorien bygger på at teksten forsøker å skjule disse motsigelsene">
			<option value="dekonstruksjonavslorer">Dekonstruksjon: Avslører motsigelser - tar sikte på å vise fram eller trevle fra hverandre motsigelser eller forskjeller i tekster. Teorien bygger på at teksten forsøker å skjule disse motsigelsene (NRK 16.4.2002)</option>
			<option value="vitenskapellerdekonstruksjon" class="addgray">Vitenskap eller intuisjon? (morgenbladet.no 11.3.2011)</option>
			<option value="hvordanunngadekonstruksjon">- Hvordan unngå justismord (uib.no 9.10.2009)</option>
			<option value="falskeforteljingar" class="addgray">Falske forteljingar med fatale følgjer (Uib.no 21.4.2009)</option>
			<option value="fungererikkedekonstruksjon">Advokater: Retshjælpen fungerer ikke (b.dk 23.3.2011)</option>
			<option value="ennsverdetdekonstruksjon">Pennen er mektigere enn sverdet  (The pen is mightier than the sword) (en.wiktionary.org  (2.3.2010)</option> 
			<option value="spraketsforsvinningdekonstruksjon" class="addgray">- Språkets forsvinning (uib.no 13.10.2009)</option>
			<option value="introducesunshinedekonstruksjon">Senatorer introduserer "Sunshine" i lovvedtak (Senators Introduce Sunshine in the Courtroom Act) (legaltimes.typepad.com 18.2.2011)</option> 
			<option value="viktigetapiretten" class="addgray">Viktige tap i retten for forurensningsofre i Kina (aftenposten.no 1.7.2008)</option>
			<option value="hattebyttersamrorerettssikkerhet">Samrøre hattebytte – rettssikkerhet? (morgenbladet.no 20.1.2006)</option>
			<option value="farrehvitsnipperdommes">Færre hvitsnipper dømmes (na24.no 27.10.2007)</option> 
			<option value="rettigheterforhvem">Rettigheter for hvem? (aftenposten.no 2.8.2008)</option> 
			<option value="einpersondekonstruksjon">«Ei IP-adresse er ikkje ein person (nrkbeta.no 15.2.2011)</option> 
			<option value="lovverkettilhorerderike">- Og lovverket, det tilhører også de rike (Paus om Norge) (nrk.no 30.9.2008)</option> 
			<option value="gratisjushjelp">Ønsker gratis jus-hjelp (kampanje.no 9.10.2008)</option> 
			<option value="urovekkendedekonstruksjon">- Urovekkende (nrk.no 4.9.2008)</option> 
			<option value="rettenspris">Rettens pris (...) 691 personer straffeforfulgt uten grunn (dagbladet.no 26.8.2008)</option> 
			<option value="rettssikkerhetenundergravesdekonstruksjon">Rettssikkerheten undergraves (aftenposten.no 23.12.2007)</option> 
			<option value="kostnaderrettssaker">Nye regler tvinger legemidelfirmaer til å offentliggjøre kostnader for rettssaker (pharmalot.com 8.8.2008)</option> 
			<option value="bigpharmasbuddies">Big Pharma's buddies (Big pharmas venner)</option> 
			<option value="legersintegritet">Legers integritet, kompetanse og kvalitet (mintankesmie.no)</option>
			<option value="unntaketsom">Dommer innrapporterer muligens leder i legemiddelfirma til riksadvokaten (BMJ 2004;328:243 (31 January))</option> 
			<option value="garantistforlegemiddelsikkerhet">Leger: Søksmål bidrar som garantist for legemiddelsikkerhet (usatoday.com 15.8.2008)</option> 
			<option value="malarebevisvurderingdekon">Mener jurister og politifolk må lære bevisvurdering (vg.no 9.6.2008)</option> 
			<option value="viktigetapiretten">Viktige tap i retten for forurensningsofre i Kina (aftenposten.no 1.7.2008)</option>
			<option value="tildemsomerbekymret">Til dem som er bekymret for kostnadsnivået er det bare en ting å si: Ja, kriminalitet er dyrt for samfunnet. Hvis vi ikke bekjemper den, blir det bare mer lønnsomt for forbryterne (dagbladet.no 12.3.2006)</option>
			</optgroup>
	</select>
</div>	
</form>
 
<p><a href="http://www.mintankesmie.no/cui_bono_picture.php">Dekonstruksjon?</a> </p>
		  <p><strong>Hva dekonstruksjonen ikke er? Alt, selvf&oslash;lgelig! </strong><br />
  Hva dekonstruksjonen er? Ingenting! (<a href="#alt_selvfolgelig">Agora nr 1-2, 2005 - Derrida H. Aschehoug &amp; Co (W.Nygaard)</a>)</p>
		  <p><strong>- Spr&aring;kets forsvinning</strong> 
(<a href="#sprakets_forsvinning">uib.no 9.10.2009</a>)		  </p>
		  <p><strong>Kafka-retspleje</strong> (<a href="#kafkask_rettspleie">jyllands-posten.dk 5.6.2013</a>)</p>
		  <p><strong>Hvordan unng&aring; justismord </strong>(<a href="#hvordan_unnga">uib.no 9.10.2009</a>) </p>
		  <p><strong>Det er dessuten normalt, forutsigelig og &oslash;nskelig</strong> at dekonstruktive studier munner ut i rettens, lovens og rettferdighetens problemfelt. (<a href="#i_rettens_lovens_og_rettferdighetens">Jacques Derridas. Lovens makt - Autoritetens mystiske begrunnelse (Force de loi. Le &rdquo;Foundement mystique de l&rsquo;autoriteté&rdquo;)</a>)</p>
		  <p><strong>Menneskerettighetene er et forsvarsverk mot handlinger fra offentlige myndigheter. </strong>Det er derfor avgj&oslash;rende med kontroll av uavhengige domstoler. (<a href="#grunnloven_ma_styrkes">aftenposten.no 22.4.2006</a>) </p>
		</div>
					<div class="second">
					  <form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Interessekonflikter - Cui bono?</option>
		<optgroup label="Samrøre - interessekonflikter – rettssikkerhet">
			<option value="cuibono">Cui bono?</option>
			<option value="knowdogap">Know-do gap</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="sivilsaker">Sivilsaker</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="utleggtvangsinndrivelse">Utlegg (tvangsinndrivelse av pengekrav)</option>
			<option value="prosedyre">Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)</option>
			<option value="justismord">Justismord (og rettssikkerhet)</option>
			<option value="synespolitikernelagetdarliglovcui">- Elendig rettssikkerhet for fattige (aftenposten.no 20.8.2007)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="loverlovdata">Lover (lovdata.no) og rettssikkerhet</option>
			<option value="klagepadommere">Klage på dommere, løgn, sakkyndighet osv.</option>
			<option value="klagepaadvokat">Klage på advokat - Hva kan man klage over? (Den Norske Advokatforening)</option>
			<option value="rulebynobody">Rule by nobody - ondskapens filosofi</option>
			</optgroup>
	</select>
</div>	
</form>
 
		    <p><strong>Avsk&aring;ret fra rettferdig rettergang </strong></p>
		    <p>Hvad nytter det, at <a href="http://www.lovdata.no/cgi-wift/ldles?doc=/all/nl-19990521-030.html#6">Menneskeretskonventionen paragraf 6</a> giver enhver ret til en <a href="http://www.menneskeret.dk/menneskeretieuropa/konventionen/">retf&aelig;rdig rettergang</a>, hvis omkostningerne er s&aring; h&oslash;je og processen s&aring; kompliceret, at almindelige borgere reelt er afsk&aring;ret fra at anvende domstolene? (<a href="#publikums_rettssikkerhet">Forbrugerr&aring;det 18.05.2004</a>) </p>
		    <p><strong>There are known knowns</strong>... (<a href="http://www.brainyquote.com/quotes/quotes/d/donaldrums148142.html">Donald Rumsfeld</a>)</p>
					</div>
			<div ></div>
					<div class="third">
					  <form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Makt og demokrati</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="maktogdemokratiutredningen">Makt og demokratiutredningen</option>
			<option value="informasjonversuskunnskapogmakt">Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			<option value="lobbyisme">Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon)</option>
			<option value="tankesmier">Tankesmier</option>
			<option value="etikkbutikk">Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="skattskattesvindel">Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)</option>
			<option value="okokrim">Økokrim (økonomisk kriminalitet / miljøkriminalitet)</option>
			<option value="ledelse">Ledelse, lederlønninger, pensjoner  etc.</option>
			<option value="offentligforvaltning">Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="habilitet">Habilitet</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="klimamiljoogglobalisering">Klima, miljø og globalisering</option>
			<option value="hvemlyver">Hvem lyver om Irak</option>
			</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Språk, utdanning, dekonstruksjon, informasjon og kunnskap (know-do gap)</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="cuibono">Cui bono?</option>
			<option value="knowdogap">Know-do gap</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="rulebynobody">Rule by nobody - ondskapens filosofi</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="skrivekunst">Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap</option>
			<option value="sprak">Språk, språkforståelse og utdanning</option>
			<option value="engelsknorsk">Engelsk - norsk</option>
			<option value="googletranslatetranslatetext">Google Translate Text (Oversettelse av tekst, nettsider og dokumenter)</option>
			<option value="googletranslateanotherlanguage">Google Translate (Søk i nettsteder på andre språk)</option>
			<option value="medisinskeordoguttrykk">Medisinske ord og uttrykk – forklaringer og oversettelser etc.</option>
			<option value="bibliotekerabm">Biblioteker ABM-utvikling (Statens senter for arkiv, bibliotek og museum)</option>
		</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="cuibono">Cui bono?</option>
			<option value="knowdogap">Know-do gap</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="sivilsaker">Sivilsaker</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="utleggtvangsinndrivelse">Utlegg (tvangsinndrivelse av pengekrav)</option>
			<option value="prosedyre">Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)</option>
			<option value="justismord">Justismord (og rettssikkerhet)</option>
			<option value="synespolitikernelagetdarliglovcui">- Elendig rettssikkerhet for fattige (aftenposten.no 20.8.2007)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="lognpisspreikellersannhet">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="loverlovdata">Lover (lovdata.no) og rettssikkerhet</option>
			<option value="klagepadommere">Klage på dommere, løgn, sakkyndighet osv.</option>
			<option value="klagepaadvokat">Klage på advokat - Hva kan man klage over? (Den Norske Advokatforening)</option>
			<option value="rulebynobody">Rule by nobody - ondskapens filosofi</option>
			</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Firmasponsede rapporter, lobbyisme, tankesmier, PR-rådgivere, PR-byråer og PR-hjelp</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="econ">Econ Pöyry</option>
			<option value="pharmecon">PharmEcon AS - Legemiddeløkonomisk Kompetanse</option>
			<option value="imshealth">IMS Health</option>
			<option value="lobbyisme">Lobbyisme</option>
			<option value="tankesmier">Tankesmier</option>
			<option value="politikkpolitikere">Politikk, politikere og troverdighet</option>
			<option value="veldedighetsdonasjonerlegemiddelindustrien">Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)</option>
			<option value="offentligegranskninger">Offentlige granskninger</option>
			<option value="offentligforvaltning">Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)</option>
			<option value="prradgivereprbyraer">PR-rådgivere, PR-byråer og PR-hjelp</option>
			</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Manglende dekonstruksjon og rettssikkerhet innen rettsvesenet</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="sivilsaker">Sivilsaker</option>
			<option value="dekonstruksjon">Dekonstruksjon og rettssikkerhet</option>
			<option value="justismord">Justismord (og rettssikkerhet)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="amerikansketilstander">Amerikanske tilstander</option>
			<option value="gruppesoksmol">Gruppesøksmål</option>
			<option value="utleggtvangsinndrivelse">Utlegg (tvangsinndrivelse av pengekrav)</option>
			<option value="gjeldsproblemer">Gjeldsproblemer og løsninger</option>
			</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Rettssikkerhet (honorarer, rettssakers forløp etc.)</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="soksmol">Søksmål</option>
			<option value="advokater">Advokater (rettshjelp)</option>
			<option value="sakkyndigelegersintegritet">Sakkyndiges legers integritet, partiskhet og habilitet versus løgn i rettssalen</option>
			<option value="prosedyre">Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)</option>
			<option value="dommereogdomstoler">Dommere og domstoler</option>
			<option value="saksomkostningermenigmanns">Saksomkostninger (menigmanns ruin) (sakskostnader)</option>
			<option value="anke">Anke</option>
			</optgroup>
	</select>
</div>	
</form><form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Medisinsk informasjon</option>
		<optgroup label="(SNARVEI - diverse relaterte temaer)">
			<option value="medisinskeordoguttrykk">Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)</option>
			<option value="pubmed2">PubMed (NCBI) (Søk i medisinske artikler og studier)</option>
			<option value="medilexicon2">Medilexicon (Forkortelser og definisjoner)</option>
			<option value="medilexicondictionary2">Medilexicon (Medical Dictionary, Medical Terminology)</option>
			<option value="merckmanual2">Merck Manual (Medisinske ord og uttrykk)</option>
			<option value="fritilgangtil">Fri tilgang til forskningsresultater? (forskningsdata)</option>
			<option value="wikileaks">WikiLeaks</option>
			<option value="medisinskevarslere">Varslere (medisinske varslere) (whistleblowers) etc.</option>
			<option value="tidsskrifteroguavhengighet">Medisinske tidsskrifter og uavhengighet</option>
			<option value="manglendeapenhetomlegersinteressekonflikter">Manglende åpenhet om legers interessekonflikter</option>			
			<option value="pengersinnflytelsepamedisinskforskning">Pengers innflytelse på medisinsk forskning</option>
			<option value="whoomlegemiddelforsok">WHO (Verdens helse-organisasjon) om legemiddelinformasjon og legemiddelforsøk</option>
			<option value="informasjonversuskunnskapogmakt">Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)</option>
			</optgroup>
	</select>
</div>	
</form><form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Søk i medisinske artikler og studier etc.</option>
		<optgroup label="(SNARVEI - se også søkefunksjoner midtfelt)">
			<option value="pubmed2">PubMed (NCBI) (Søk i medisinske artikler og studier)</option>
			<option value="merriammuttale">MERRIAM WEBSTER'S ONLINE (Engelsk ordbok) (m/uttale)</option>
			<option value="merriamwebstersmedicaldictionarymedlineplus">MERRIAM WEBSTER'S Medical Dictionary (Medisinsk ordbok - MedlinePlus)</option>	
			<option value="merriamwebstersmedicaldictionary">MERRIAM WEBSTER' Medical Dictionary (Medisinsk leksikon - UCSF Medical Center)</option>			
			<option value="merckmanual">Merck Manual (Medisinske ord og uttrykk)</option>				
			<option value="nhino2">NHI.no - søk i publikumsutgaven av Legehåndboka (NEL)</option> 
			<option value="norskmedisinsk">Norsk medisinsk ordbok (Samlaget)</option>
			<option value="norsklegemiddelhandbok">Norsk legemiddelhåndbok (oppslagsbok om legemidler)</option>
			<option value="medisinerlatin">Medicinska termer ("medisinerlatin") (Karolinska Institutet - Latin och grekiska till svenska)</option>
			<option value="medicaldictionary">MedlinePlus (NIH) Medical Dictionary (Medisinsk ordbok)</option>					
			<option value="medicalencyclopedia">MedlinePlus (NIH) Medical Encyclopedia (Medisinsk leksikon)</option>	
			<option value="merriamwebstersmedicaldictionary">Merriam-Webster's Medical Dictionary (Medisinsk leksikon - UCSF Medical Center)</option>			
			<option value="stedmans">Stedman's Medical Dictionaries (The Best Words in Medicine)</option>				
			</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Oversettelser (autoriserte oversettelser etc.)</option>
		<optgroup label="Finn en oversetter">
			<option value="oversetterforeningnff">NFF (Forfattere og oversettere)</option>
			<option value="finnenoversetternff">Forfattere og oversettere (NFF)</option>
			<option value="andrelenkernff">Andre nyttige lenker (NFF))</option> 
			<option value="lenkesamlingnff">Lenkesamling (Norsk faglitterær forfatter- og oversetterforening (NFF))</option>
			<option value="oversetterrstf">Statsautoriserte Translatørers Forening (STF)</option>
			<option value="translatorbabyloncom">Babylon Human Translation (Get it done in less than 1 hour!)</option>
			</optgroup>
	</select>
</div>	
</form>
<form method="post" action="sok.php" class="liten">
<div>
	<select name="google" onchange="this.form.submit()">
			<option value="sikkerhetslosninger">Tolk</option>
		<optgroup label="Bruk internett som tolk">
			<option value="finnentolk">Nasjonalt tolkeregister</option>
			<option value="internettsom">Bruk internett som tolk (helsebiblioteket.no)</option> 
			<option value="googletranslatetranslatetext">Google Translate Text (Oversettelse av tekst, nettsider og dokumenter)</option>
			<option value="googletranslateanotherlanguage">Google Translate (Søk på andre språk)</option>
			</optgroup>
	</select>
</div>	
</form>
				 </div>
				</div>
				<div class="bottom"></div>
				</div>
				
				<div class="wrap">
				 <div class="sidebar">
				    <ul class="tabs">
					  <li class="first"><a href="#mintankesmie" class="active">MinTankesmie</a></li>
					  <li><a href="#linker">LENKER</a></li>
				</ul>
				    <div class="tab1" id="mintankesmie">
					  <div><div>
<div class="arrowlistmenu">
   <h3 class="menuheader expandable">Om foretaket (About)</h3>
   <ul class="categoryitems">
   	 <li><a href="http://www.mintankesmie.no/om_foretaket.php" title="Om foretaket (About)">Om foretaket (About)</a></li>
	 <li><a href="a_a_mintankesmie.php" title="A til Å index">A til Å index</a></li>
	 <li><a href="1_300_mintankesmie.php" title="A til Å (1 - 300)">A til Å (1 - 300)</a></li>
   </ul>
   <h3 class="menuheader expandable">Generell informasjon</h3>
   <ul class="categoryitems">
		<li><a href="lykke_happiness.php" title="Lykke (Happiness)">Lykke (Happiness)</a></li>
		<li><a href="fysisk_trening.php" title="Fysisk trening (aktivitet / l&oslash;ping / jogging)">Fysisk trening (aktivitet / løping / jogging)</a></li>
		<li><a href="politikk_politikere_og_troverdighet.php" title="Politikk, politikere og troverdighet">Politikk, politikere og troverdighet</a></li>
		<li><a href="lobbyisme.php" title="Lobbyisme">Lobbyisme</a></li>
		<li><a href="makt_og_demokratiutredningen.php" title="Makt og demokratiutredningen">Makt og demokratiutredningen</a></li>
		<li><a href="wikileaks.php" title="WikiLeaks">WikiLeaks</a></li>
		<li><a href="forskning_og_ressurser.php" title="Forskning og ressurser">Forskning og ressurser</a></li>
		
		<li><a href="uredelighet_og_fusk_medisinsk_forskning.php" title="Uredelighet og fusk i medisinsk forskning">Uredelighet og fusk i medisinsk forskning</a></li>
		<li><a href="varslere_medisinske_varslere_whistleblowers.php" title="Varslere (medisinske varslere) (whistleblowers) etc.">Varslere (medisinske varslere) (whistleblowers) etc.</a></li>
		<li><a href="etikk_butikk_politikk_veldedighet_og_interessekonflikter.php" title="Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter">Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter</a></li>
		<li><a href="interessekonflikter_bestikkelser_og_korrupsjon.php" title="Interessekonflikter, bestikkelser og korrupsjon">Interessekonflikter, bestikkelser og korrupsjon</a></li>
		<li><a href="fattigdom_fordelingspolitikk_og_rikdom.php" title="Fattigdom, fordelingspolitikk (bistand) og rikdom">Fattigdom, fordelingspolitikk (bistand) og rikdom</a></li>
		<li><a href="bank_bors_og_finans.php" title="Bank, b&oslash;rs og finans">Bank, børs og finans</a></li>
		<li><a href="finanstilsynet.php" title="Finanstilsynet (tidligere Kredittilsynet)">Finanstilsynet (tidligere Kredittilsynet)</a></li>
		<li><a href="skatt_skattesvindel_og_skattemyndigheter.php" title="Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)">Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)</a></li>
		<li><a href="klima_miljo_og_globalisering.php" title="Klima, miljø og globalisering">Klima, miljø og globalisering</a></li>
		<li><a href="arbeidsmiljo_yrkesskader_og_arbeidsrett.php" title="Arbeidsmilj&oslash;, yrkesskader og arbeidsrett">Arbeidsmiljø, yrkesskader og arbeidsrett (    )</a></li>
		<li><a href="gjeldsproblemer_og_losninger.php" title="Gjeldsproblemer, gjeldsoffer og løsninger">Gjeldsproblemer, gjeldsoffer og løsninger</a></li>
		<li><a href="ideutvikling_kreativitet_og_grundervirksomhet.php" title="Idéutvikling, kreativitet, gründervirksomhet etc.">Idéutvikling, kreativitet, gründervirksomhet etc.</a></li>
		<li><a href="engelsk_norsk.php" title="Engelsk-norsk (flerspr&aring;klige ordb&oslash;ker etc.)">Engelsk-norsk (flerspråklige ordbøker etc.)</a></li>
		<li><a href="medisinske_ord_og_uttrykk_symptomer_forklaringer_og_oversettelser.php" title="Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)">Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)</a></li>
		<li><a href="sok_sokemotorer_sokeord_annonsering_internett.php" title="S&oslash;k, s&oslash;kemotorer, s&oslash;keord, annonsering; internett">Søk, søkemotorer, søkeord, annonsering; internett</a></li>
		<li><a href="diverse_datatips.php" title="Diverse datatips">Diverse datatips</a></li>
		<li><a href="ytringsfrihet_og_offentlighet.php" title="Ytringsfrihet og offentlighet">Ytringsfrihet og offentlighet</a></li>
		<li><a href="offentlige_granskninger.php" title="Offentlige granskninger">Offentlige granskninger</a></li>
		<li><a href="sakkyndige_legers_integritet_partiskhet_og_habilitet.php" title="Sakkyndige legers integritet, partiskhet og habilitet versus l&oslash;gn i rettssalen">Sakkyndige legers integritet, partiskhet og habilitet versus løgn i rettssalen (sakkyndighet)</a></li>
		<li><a href="legers_integritet_kompetanse_og_kvalitet.php" title="Legers integritet, kompetanse og kvalitet">Legers integritet, kompetanse og kvalitet</a></li>
		<li><a href="pasientjournaler_og_epikriser.php" title="Pasientjournaler og epikriser">Pasientjournaler og epikriser</a></li>
		<li><a href="logn_pisspreik_eller_sannhet.php" title="Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)">Løgn, pisspreik (bullshit) eller sannhet? (Løgn i norske rettssaler)</a></li>
		<li><a href="advokater.php" title="Advokater (rettshjelp)">Advokater (rettshjelp) (mintankesmie.no)</a></li>
		<li><a href="cui_bono.php" title="Cui bono?">Cui bono?</a></li>
		<li><a href="know_do_gap.php" title="Know-do gap">The know-do gap</a></li>
		<li><a href="dekonstruksjon_og_rettssikkerhet.php" title="Dekonstruksjon og rettssikkerhet">Dekonstruksjon og rettssikkerhet</a></li>
		<li><a href="justismord.php" title="Justismord">Justismord (og rettssikkerhet)</a></li>
		<li><a href="dommere_og_domstoler.php" title="Dommere og domstoler">Dommere og domstoler</a></li>
		<li><a href="saksomkostninger_menigmanns_ruin.php" title="Saksomkostninger (menigmanns ruin) (sakskostnader)">Saksomkostninger (menigmanns ruin) (sakskostnader)</a></li>
		<li><a href="okokrim.php" title="&Oslash;kokrim">Økokrim (økonomisk kriminalitet / miljøkriminalitet)</a></li>
		<li><a href="politiet_etterforskning_politianmeldelser_osv.php" title="Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)">Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)</a></li>
		<li><a href="diverse_forbrukertips.php" title="Diverse forbrukertips">Diverse forbrukertips</a></li>
		<li><a href="sport_og_spill.php" title="Sport og spill">Sport og spil</a></li>
		<li><a href="vioxx_informasjon_versus_kunnskap_og_visdom_hvem_visste_hva.php" title="Vioxx - informasjon versus kunnskap og visdom - hvem visste hva?">Vioxx - informasjon versus kunnskap og visdom - hvem visste hva?</a></li>
		<li><a href="avandia_informasjon_versus_kunnskap_og_visdom_hvem_visste_hva.php" title="Avandia (rosiglitazone) - informasjon versus kunnskap og visdom - hvem visste hva?">Avandia (rosiglitazone) - informasjon versus kunnskap og visdom - hvem visste hva?</a></li>
		<li><a href="thalidomide.php" title="Thalidomide (Thalidomid) - informasjon versus kunnskap og visdom - hvem visste hva?">Thalidomide (Thalidomid) - informasjon versus kunnskap og visdom - hvem visste hva?</a></li>
   </ul>
   
   <h3 class="menuheader expandable">Forskning og utvikling</h3>
   <ul class="categoryitems">
   		<li><a href="fri_tilgang_til_forskningsresultater.php" title="Fri tilgang til forskningsresultater? (forskningsdata)">Fri tilgang til forskningsresultater? (forskningsdata)</a></li>
		<li><a href="forskning_og_ressurser.php" title="Forskning og ressurser">Forskning og ressurser</a></li>
		<li><a href="statlig_legemiddelkontroll.php" title="Statlig legemiddelkontroll (Statens legemiddelverk)">Statlig legemiddelkontroll (Statens legemiddelverk)</a></li>
		<li><a href="uredelighet_og_fusk_medisinsk_forskning.php" title="Uredelighet og fusk i medisinsk forskning">Uredelighet og fusk i medisinsk forskning</a></li>
		<li><a href="spokelsesforfattere_ghostwriters.php" title="Sp&oslash;kelsesforfattere (ghostwriters), legemidler og forskning">Spøkelsesforfattere (ghostwriters), legemidler og forskning</a></li>
		<li><a href="skiftet_fra_akademiske_til_kommersielle_legemiddelnettverk.php" title="Skiftet fra akademiske til kommersielle legemiddelnettverk">Skiftet fra akademiske til kommersielle legemiddelnettverk</a></li>
		<li><a href="er_leger_forskere.php" title="Er leger forskere?">Er leger forskere?</a></li>
		<li><a href="legemiddelstudier_apenhet_uredelighet_og_kvalitet.php" title="Legemiddelstudier, &aring;penhet, uredelighet og kvalitet">Legemiddelstudier, åpenhet, uredelighet og kvalitet</a></li>
		<li><a href="legemiddelstudier_forfattere_medforfattere_forskningsjuks.php" title="Legemiddelstudier, forfattere, medforfattere, forskningsjuks etc.">Legemiddelstudier, forfattere, medforfattere, forskningsjuks etc.</a></li>
		<li><a href="regionale_komiteer_for_medisinsk_forskningsetikk_rek.php" title="Regionale komiteer for medisinsk forskningsetikk (REK)">Regionale komiteer for medisinsk forskningsetikk (REK)</a></li>
		<li><a href="legemiddelutprovning_legemiddelkontroll_og_legemiddelkriminalitet.php" title="Legemiddelutprøvning, legemiddelkontroll og legemiddelkriminalitet">Legemiddelutprøvning, legemiddelkontroll og legemiddelkriminalitet</a></li>
		<li><a href="forskrivning_utenfor_preparatomtale.php" title="Forskrivning utenfor preparatomtale (&quot;off label&quot;) (utenfor indikasjon)">Forskrivning utenfor preparatomtale ("off label") (utenfor indikasjon)</a></li>
   </ul>
   
   <h3 class="menuheader expandable">Medisinsk informasjon</h3>
   <ul class="categoryitems">
	     <li><a href="medisinske_ord_og_uttrykk_symptomer_forklaringer_og_oversettelser.php" title="Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)">Medisinske ord og uttrykk (symptomer, forklaringer, oversettelser etc.)</a></li>
		 
		<li><a href="fri_tilgang_til_forskningsresultater.php" title="Fri tilgang til forskningsresultater? (forskningsdata)">Fri tilgang til forskningsresultater? (forskningsdata)</a></li>
		<li><a href="varslere_medisinske_varslere_whistleblowers.php" title="Varslere (medisinske varslere) (whistleblowers) etc.">Varslere (medisinske varslere) (whistleblowers) etc.</a></li>
		<li><a href="wikileaks.php" title="WikiLeaks">WikiLeaks</a></li>
		<li><a href="medisinske_tidsskrifter_og_uavhengighet.php" title="Medisinske tidsskrifter og uavhengighet">Medisinske tidsskrifter og uavhengighet</a></li>
		<li><a href="manglende_apenhet_om_legers_interessekonflikter.php" title="Manglende &aring;penhet om legers interessekonflikter">Manglende åpenhet om legers interessekonflikter</a></li>
		<li><a href="pengers_innflytelse_pa_medisinsk_forskning.php" title="Pengers innflytelse p&aring; medisinsk forskning">Pengers innflytelse på medisinsk forskning</a></li>
		<li><a href="who_om_legemiddelforsok.php" title="WHO (World Health Organization) om legemiddelinformasjon og legemiddelfors&oslash;k">WHO (Verdens helse-organisasjon) om legemiddelinformasjon og legemiddelforsøk</a></li>
		<li><a href="informasjon_versus_kunnskap_og_makt_kommersialisering_og_monopolisering_av_kunnskap.php" title="Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)">Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)</a></li>
   </ul>
   
   <h3 class="menuheader expandable">Firmasponset produktinformasjon</h3>
   <ul class="categoryitems">
		<li><a href="sponsing_av_journalistikk.php" title="Sponsing av journalistikk">Sponsing av journalistikk</a></li>
		<li><a href="pasientforeninger_legemiddelfirmasponset_helseinformasjon.php" title="Pasientforeninger (legemiddelfirmasponset helseinformasjon)">Pasientforeninger (legemiddelfirmasponset helseinformasjon)</a></li>
		<li><a href="legenettsteder_legemiddelfirmasponset_helseinformasjon.php" title="Legenettsteder (legemiddelfirmasponset helseinformasjon)">Legenettsteder (legemiddelfirmasponset helseinformasjon)</a></li>
		<li><a href="dagens_medisin_legemiddelfirmasponset_helseinformasjon.php" title="Dagens Medisin, NHI.no (Norsk Helseinformatikk) (Medicinsktidsskrift.dk) (annonsesponset helseinformasjon - Bonnier)">Dagens Medisin, NHI.no (Norsk Helseinformatikk) (Medicinsktidsskrift.dk) (annonsesponset helseinformasjon - Bonnier)</a></li>
		<li><a href="norsk_farmaceutisk_tidsskrift_nft.php" title="Norsk Farmaceutisk Tidsskrift (NFT)  (legemiddelfirmasponset helseinformasjon)">Norsk Farmaceutisk Tidsskrift (NFT)  (legemiddelfirmasponset helseinformasjon)</a></li>
		<li><a href="hjelpeorganisasjoner_veldedighetsdonasjoner.php" title="Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)">Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)</a></li>
		<li><a href="legemiddelreklame.php" title="Legemiddelreklame (legemiddelinformasjon)">Legemiddelreklame (legemiddelinformasjon)</a></li>
		<li><a href="legemiddelinformasjon.php" title="Legemiddelinformasjon">Legemiddelinformasjon</a></li>
		<li><a href="legemiddelkonsulenter.php" title="Legemiddelkonsulenter (sales representatives)">Legemiddelkonsulenter (sales representatives)</a></li>
		<li><a href="skiftet_fra_akademiske_til_kommersielle_legemiddelnettverk.php" title="Skiftet fra akademiske til kommersielle legemiddelnettverk">Skiftet fra akademiske til kommersielle legemiddelnettverk</a></li>
		<li><a href="salg_av_sykdom.php" title="Salg av sykdom sykdomssalg">Salg av sykdom</a></li>
		<li><a href="legemiddelindustrien.php" title="Legemiddelindustrien (Big pharma)">Legemiddelindustrien (Big pharma)</a></li>
		<li><a href="legemiddelindustriforeninger.php" title="Legemiddelindustriforeninger">Legemiddelindustriforeninger</a></li>
		<li><a href="lobbyisme.php" title="Lobbyisme">Lobbyisme</a></li>
		<li><a href="tankesmier.php" title="Tankesmier">Tankesmier</a></li>
		<li><a href="politikk_politikere_og_troverdighet.php" title="Politikk, politikere og troverdighet">Politikk, politikere og troverdighet</a></li>
   </ul>
   
   <h3 class="menuheader expandable">Opphavsrett, ytringsfrihet, undersøkende journalistikk etc.</h3>
   <ul class="categoryitems">
	     <li><a href="opphavsrett_copyright_og_fair_use.php" title="Opphavsrett (copyright) og Fair Use">Opphavsrett (copyright) og Fair Use</a></li>
		<li><a href="ytringsfrihet_og_offentlighet.php" title="Ytringsfrihet og offentlighet">Ytringsfrihet og offentlighet</a></li>
		<li><a href="institusjonen_fritt_ord.php" title="Fritt Ord (Institusjonen Fritt Ord)">Fritt Ord (Institusjonen Fritt Ord)</a></li>
		<li><a href="pfu_pressens_faglige_utvalg.php" title="PFU (Pressens Faglige Utvalg)">PFU (Pressens Faglige Utvalg)</a></li>
		<li><a href="skup_kritisk_og_undersokende_presse.php" title="SKUP (Stiftelsen for en Kritisk og Unders&oslash;kende Presse)">SKUP (Stiftelsen for en Kritisk og Undersøkende Presse)</a></li>
		<li><a href="the_open_institute_osi.php" title="The Open Society Institute (OSI) (George Soros)">The Open Society Institute (OSI) (George Soros)</a></li>
		<li><a href="propublica.php" title="ProPublica (Journalism in the Public Interest)">ProPublica (Journalism in the Public Interest)</a></li>
		<li><a href="public_citizen.php" title="Public Citizen">Public Citizen</a></li>
		<li><a href="undersokende_journalistikk.php" title="Unders&oslash;kende (gravende) journalistikk">Undersøkende (gravende) journalistikk</a></li>
		<li><a href="sponsing_av_journalistikk.php" title="Sponsing av journalistikk">Sponsing av journalistikk</a></li>
   </ul>

<h3 class="menuheader expandable">Språk, utdanning, dekonstruksjon, informasjon og kunnskap (know-do gap)</h3>
<ul class="categoryitems">
<li><a href="cui_bono.php" title="Cui bono?">Cui bono?</a></li>
<li><a href="know_do_gap.php" title="Know-do gap">The know-do gap</a></li>
<li><a href="dekonstruksjon_og_rettssikkerhet.php" title="Dekonstruksjon og rettssikkerhet">Dekonstruksjon og rettssikkerhet</a></li>
<li><a href="justismord.php" title="Justismord">Justismord (og rettssikkerhet)</a></li>
<li><a href="logn_pisspreik_eller_sannhet.php" title="Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)">Løgn, pisspreik (bullshit) eller sannhet? (Løgn i norske rettssaler)</a></li>
<li><a href="ondskapens_filosofi_rule_by_nobody.php" title="Ondskapens filosofi (“rule by nobody”)">Ondskapens filosofi (“rule by nobody”)</a></li>
<li><a href="skrivelyst_skrivekunst_lesekunst_informasjon_og_kunnskap.php" title="Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap">Skrivelyst, skrivekunst, lesekunst, informasjon og kunnskap</a></li>
<li><a href="sprak_sprakforstaelse_og_utdanning.php" title="Spr&aring;k, spr&aring;kforst&aring;else og utdanning">Språk, språkforståelse og utdanning</a></li>
<li><a href="medisinske_ord_og_uttrykk_symptomer_forklaringer_og_oversettelser.php" title="Medisinske ord og uttrykk &ndash; forklaringer og oversettelser">Medisinske ord og uttrykk forklaringer og oversettelser</a></li>
<li><a href="biblioteker_abm.php" title="Biblioteker ABM-utvikling (Statens senter for arkiv, bibliotek og museum)">Biblioteker - ABM-utvikling (Statens senter for arkiv, bibliotek og museum / Arkivverket - Riksarkivet, åtte statsarkiver, Samisk arkiv og Norsk helsearkiv.)</a></li>
</ul>

<h3 class="menuheader expandable">Reklame, journalisitikk, medieovervåkning, sponsing, juks, propaganda etc.</h3>
<ul class="categoryitems">
<li><a href="medietilsynet.php" title="Medietilsynet">Medietilsynet</a></li>
<li><a href="media.php" title="Media (mediekritikk)">Media (mediekritikk)</a></li>
<li><a href="reklame_sponsing_journalistikk_spin_og_pr_virksomhet.php" title="Reklame, sponsing, journalistikk, spin og PR-virksomhet">Reklame, sponsing, journalistikk, spin og PR-virksomhet</a></li>
<li><a href="sponsing_av_journalistikk.php" title="Sponsing av journalistikk">Sponsing av journalistikk</a></li>
<li><a href="profitt_journalistikk_juks_omdomme_og_propaganda.php" title="Profitt, journalistikk, juks, omd&oslash;mme og propaganda">Profitt, journalistikk, juks, omdømme og propaganda</a></li>
<li><a href="medieovervakning_medieanalyse_monopol_og_tekstreklame.php" title="Medieoverv&aring;kning, medieanalyse, monopol og tekstreklame">Medieovervåkning, medieanalyse, monopol og tekstreklame</a></li>
<li><a href="sok_sokemotorer_sokeord_annonsering_internett.php" title="Søk, søkemotorer, søkeord, annonsering, internett etc.">Søk, søkemotorer, søkeord, annonsering; internett</a></li>
</ul>

<h3 class="menuheader expandable">Gaver, smøring, gratis lunch, interessekonflikter, habilitet, varslere, korrupsjon etc.</h3>
<ul class="categoryitems">
<li><a href="gaver_smoring_bestikkelser_etc.php" title="Gaver, smøring (gave gitt som bestikkelse) etc.">Gaver, smøring (gave gitt som bestikkelse) etc.</a></li>
<li><a href="gratis_lunch_legemidler_gradighetskultur_og_korrupsjon.php" title="Gratis lunch, legemidler, gr&aring;dighetskultur og korrupsjon">Gratis lunch, legemidler, grådighetskultur og korrupsjon</a></li>
<li><a href="interessekonflikter_bestikkelser_og_korrupsjon.php" title="Interessekonflikter, bestikkelser og korrupsjon">Interessekonflikter, bestikkelser og korrupsjon</a></li>
<li><a href="habilitet.php" title="Habilitet (integritet)">Habilitet (integritet)</a></li>
</ul>

<h3 class="menuheader expandable">Firmasponsede rapporter, Lobbyisme (lobbying - lobbyvirksomhet - lobbyregister - interessekonflikter - korrupsjon), tankesmier, PR-rådgivere, PR-byråer og PR-hjelp (PR-bransjen)</h3>
<ul class="categoryitems">
<li><a href="econ.php" title="Econ">Econ Pöyry</a></li>
<li><a href="pharmecon.php" title="PharmEcon AS- Legemiddel&oslash;konomisk Kompetanse">PharmEcon AS- Legemiddeløkonomisk Kompetanse</a></li>
<li><a href="iqvia.php" title="IQVIA (tidligere IMS Health og Quintiles)">IQVIA (tidligere IMS Health og Quintiles)</a></li>
<li><a href="lobbyisme.php" title="Lobbyisme">Lobbyisme</a></li>
<li><a href="tankesmier.php" title="Tankesmier">Tankesmier</a></li>
<li><a href="politikk_politikere_og_troverdighet.php" title="Politikk, politikere og troverdighet">Politikk, politikere og troverdighet</a></li>
<li><a href="hjelpeorganisasjoner_veldedighetsdonasjoner.php" title="Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)">Hjelpeorganisasjoner, veldedighetsdonasjoner etc. (manglende åpenhet om hvordan penger brukes)</a></li>
<li><a href="offentlige_granskninger.php" title="Offentlige granskninger">Offentlige granskninger</a></li>
<li><a href="pr_radgivere_pr_byraer_og_pr_hjelp.php" title="PR-r&aring;dgivere, PR-byr&aring;er og PR-hjelp (PR-bransjen)">PR-rådgivere, PR-byråer og PR-hjelp (PR-bransjen)</a></li>
</ul>

<h3 class="menuheader expandable">Leger, sykepleiere, tannleger, legemidler og pasientsikkerhet</h3>
<ul class="categoryitems">
<li><a href="leger_minfastlege.php" title="Leger (MinFastlege)">Leger (MinFastlege)</a></li>
<li><a href="kommunikasjon_mellom_lege_og_pasient.php" title="Kommunikasjon mellom lege og pasient">Kommunikasjon mellom lege og pasient</a></li>
<li><a href="pasientjournaler_og_epikriser.php" title="Pasientjournaler og epikriser">Pasientjournaler og epikriser</a></li>
<li><a href="feilmedisineringer_og_feilbehandlinger.php" title="Feilmedisineringer og feilbehandlinger (medisinske feil)">Feilmedisineringer og feilbehandlinger (medisinske feil)</a></li>
<li><a href="diagnostisering_feildiagnostisering_og_pasientsikkerhet.php" title="Diagnostisering, feildiagnostisering, overdiagnostisering og pasientsikkerhet">Diagnostisering, feildiagnostisering, overdiagnostisering og pasientsikkerhet</a></li>
<li><a href="pasientsikkerhet.php" title="Pasientsikkerhet (rettssikkerhet)">Pasientsikkerhet (rettssikkerhet)</a></li>
<li><a href="hygiene.php" title="Hygiene (smittsomme sykdommer / infeksjoner / smittevern)">Hygiene (smittsomme sykdommer / infeksjoner / smittevern)</a></li>
<li><a href="prestisjesykdommer.php" title="Prestisjesykdommer (sykdommers prestisje / sykdommers rangering)">Prestisjesykdommer (sykdommers prestisje / sykdommers rangering)</a></li>
<li><a href="legers_integritet_kompetanse_og_kvalitet.php" title="Legers integritet, kompetanse og kvalitet">Legers integritet, kompetanse og kvalitet</a></li>
<li><a href="bor_leger_og_sykehus_dokumentere_sin_etikk_praksis.php" title="B&oslash;r leger og sykehus dokumentere sin etikk og praksis?">Bør leger og sykehus dokumentere sin etikk og praksis?</a></li>
<li><a href="telemedisin_roboter_e_helse.php" title="Telemedisin (telehelse, e-helse, mobil helse, helseteknologi), IKT (Informasjons- og kommunikasjonsteknologi), roboter etc.">Telemedisin (telehelse, e-helse, mobil helse, helseteknologi), IKT (Informasjons- og kommunikasjonsteknologi), roboter etc.</a></li>
<li><a href="sykepleiere.php" title="Sykepleier sykepleiere helsepersonell">Sykepleiere</a></li>
<li><a href="tannleger_og_tannhelse.php" title="Tannleger og  tannhelse (munnhulen er kroppens speil)">Tannleger og  tannhelse (munnhulen er kroppens speil)</a></li>
<li><a href="straffedomte_i_helsevesenet.php" title="Straffed&oslash;mte i helsevesenet">Straffedømte i helsevesenet (straffesaker) (straffesaker)</a></li>
</ul>

<h3 class="menuheader expandable">Risikovurdering av informasjon og resultater</h3>
<ul class="categoryitems">
<li><a href="produkt_og_tjenesteanalyse.php" title="Produkt- og tjenesteanalyse">Produkt- og tjenesteanalyse</a></li>
<li><a href="screening.php" title="Screening (masseundersøkelse) av blodprøver etc.">Screening (masseundersøkelse) av blodprøver etc.</a></li>
<li><a href="risiko_versus_kostnad_nytte_verdi.php" title="Risiko-versus-kostnad-nytte-verdi (risiko versus nytteverdi)">Risiko-versus-kostnad-nytte-verdi (risiko versus nytteverdi)</a></li>
<li><a href="hvordan_lese_fortolke_en_medisinsk_artikkel.php" title="Hvordan lese/fortolke en medisinsk artikkel">Hvordan lese/fortolke en medisinsk artikkel</a></li>
<li><a href="hvordan_lese_fortolke_studieresultater.php" title="Hvordan lese/fortolke studieresultater (statistiske resultater)">Hvordan lese/fortolke studieresultater (statistiske resultater)</a></li>
<li><a href="skremselspropaganda.php" title="Skremselspropaganda">Skremselspropaganda</a></li>
</ul>

<h3 class="menuheader expandable">Offentlig forvaltning, kontroll og rettigheter</h3>
<ul class="categoryitems">
<li><a href="offentlig_forvaltning.php" title="Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)">Offentlig forvaltning (offentlige anskaffelser - offentlige innkjøp)</a></li>
<li><a href="offentlige_granskninger.php" title="Offentlige granskninger">Offentlige granskninger</a></li>
<li><a href="helse_og_omsorgsdepartementet_hod.php" title="Helse- og omsorgsdepartementet (HOD)">Helse- og omsorgsdepartementet (HOD)</a></li>
<li><a href="helsedirektoratet.php" title="Helsedirektoratet (tidligere Sosial- og helsedirektoratet (SHdir))">Helsedirektoratet (tidligere Sosial- og helsedirektoratet (SHdir))</a></li>
<li><a href="arbeids_og_velferdsdirektoratet.php" title="NAV (Arbeids- og velferdsdirektoratet) (Arbeids- og velferdsetaten (tidligere Aetat og trygdeetaten)">NAV (Arbeids- og velferdsdirektoratet) (Arbeids- og velferdsetaten (tidligere Aetat og trygdeetaten))</a></li>
<li><a href="arbeidsmiljo_yrkesskader_og_arbeidsrett.php" title="Arbeidsmilj&oslash;, yrkesskader og arbeidsrett">Arbeidsmiljø, yrkesskader og arbeidsrett (arbeidstilsynet)</a></li>
<li><a href="departementenes_og_underliggende_etaters_krisehandtering.php" title="Departementene og underliggende etaters kriseh&aring;ndtering">Departementene og underliggende etaters krisehåndtering</a></li>
<li><a href="de_regionale_helseforetakene.php" title="De regionale helseforetakene">De regionale helseforetakene</a></li>
<li><a href="helsetilsynet_statens_helsetilsyn.php" title="Statens helsetilsyn (Helsetilsynet) (SHT)">Statens helsetilsyn (Helsetilsynet) (SHT)</a></li>
<li><a href="mattilsynet_statens_mattilsyn.php" title="Statens mattilsyn (Mattilsynet)">Statens mattilsyn (Mattilsynet)</a></li>
<li><a href="statlig_legemiddelkontroll.php" title="Statlig legemiddelkontroll (Statens legemiddelverk)">Statlig legemiddelkontroll (Statens legemiddelverk)</a></li>
<li><a href="miljo_og_legemiddel.php" title="Milj&oslash; og legemiddel">Miljø og legemiddel</a></li>
<li><a href="fylkeslegen_helsetilsynet_fylkesmannen.php" title="Fylkeslegen – Helsetilsynet (Statens helsetilsyn) - Fylkesmannen - Fylkesnemndene for barnevern og sosiale saker">Fylkeslegen – Helsetilsynet (Statens helsetilsyn) - Fylkesmannen - Fylkesnemndene for barnevern og sosiale saker</a></li>
<li><a href="pasientombudet.php" title="Pasient- og brukerombudet (Pobo) (pasientombudet)">Pasient- og brukerombudet (Pobo) (pasientombudet)</a></li>
<li><a href="sivilombudsmannen.php" title="Sivilombudsmannen (SOM)">Sivilombudsmannen (SOM)</a></li>
<li><a href="eu_kommisjonen.php" title="EU-kommisjonen (Den europeiske unions høyeste organ)">EU-kommisjonen (Den europeiske unions høyeste organ)</a></li>
<li><a href="who_verdenshelseorganisasjon.php" title="WHO (World Health Organization)">WHO (World Health Organization)</a></li>
<li><a href="menneskerettigheter_menneskerettighetsdomstolen.php" title="Menneskerettigheter (Den europeiske menneskerettighetsdomstolen (EMD) i Strasbourg)">Menneskerettigheter (Den europeiske menneskerettighetsdomstolen (EMD) i Strasbourg)</a></li>
</ul>

<h3 class="menuheader expandable">Skader, dødsfall, registre, statistikk og kostnader</h3>
<ul class="categoryitems">
<li><a href="sykehus_forvaltning_skader_dodstall_og_kvalitet.php" title="Sykehus, forvaltning, skader, d&oslash;dstall og kvalitet">Sykehus, forvaltning, skader, dødstall og kvalitet</a></li>
<li><a href="helsekostnader_forskning_og_budsjetter.php" title="Helsekostnader, forsikringer, forskning og budsjetter">Helsekostnader, forsikringer, forskning og budsjetter</a></li>
<li><a href="statistikk_og_helseregistre.php" title="Statistikk og helseregistre (helsedata)">Statistikk og helseregistre (helsedata)</a></li>
<li><a href="medisinsk_fodselsregister.php" title="Medisinsk f&oslash;dselsregister (f&oslash;dselskomplikasjoner)">Medisinsk fødselsregister (fødselskomplikasjoner)</a></li>
<li><a href="kreftregisteret.php" title="Kreftregisteret">Kreftregisteret</a></li>
<li><a href="leger_dodstall_og_kvalitet.php" title="Leger d&oslash;dstall og kvalitet">Leger, dødstall og kvalitet</a></li>
</ul>

<h3 class="menuheader expandable">Statlig legemiddelkontroll, legemiddelsikkerhet og økonomi</h3>
<ul class="categoryitems">
<li><a href="legemiddelokonomi_bivirkninger_og_legemiddelomsetning.php" title="Legemiddel&oslash;konomi, bivirkninger og legemiddelomsetning">Legemiddeløkonomi, bivirkninger og legemiddelomsetning</a></li>
<li><a href="legemiddelretur_kassasjon.php" title="Legemiddelretur (kassasjon) (Legemidler er farlig avfall)">Legemiddelretur (kassasjon) (Legemidler er farlig avfall)</a></li>
<li><a href="miljo_og_legemiddel.php" title="Milj&oslash; og legemiddel">Miljø og legemiddel</a></li>
<li><a href="legemiddel_og_annen_substansavhengighet.php" title="Legemiddelavhengighet og annen substansavhengighet">Legemiddelavhengighet og annen substansavhengighet</a></li>
<li><a href="statlig_legemiddelkontroll.php" title="Statlig legemiddelkontroll (Statens legemiddelverk)">Statlig legemiddelkontroll (Statens legemiddelverk)</a></li>
<li><a href="kunnskapssenteret.php" title="Kunnskapssenteret (Nasjonalt kunnskapssenter for helsetjenesten)">Kunnskapssenteret (Nasjonalt kunnskapssenter for helsetjenesten)</a></li>
<li><a href="bivirkninger_og_bivirkningsovervakning.php" title="Bivirkninger og bivirkningsoverv&aring;kning">Bivirkninger og bivirkningsovervåkning</a></li>
<li><a href="statlig_bivirkningsovervakning.php" title="Statlig bivirkningsoverv&aring;kning">Statlig bivirkningsovervåkning</a></li>
<li><a href="legemiddel_pakningsvedlegg_legemidler.php" title="Legemiddel - pakningsvedlegg (legemiddelinformasjon)">Legemiddel - pakningsvedlegg (legemiddelinformasjon)</a></li>
<li><a href="legemiddel_preparatomtaler_spc_legemidler.php" title="Legemiddel - preparatomtaler (SPC) og pakningsvedlegg">Legemiddel - preparatomtaler (SPC) og pakningsvedlegg</a></li>
<li><a href="diverse_legemiddelkontrollorganer.php" title="Diverse kontrollorganer (enheter) for legemidler og medisinsk utstyr">Diverse kontrollorganer (enheter) for legemidler og medisinsk utstyr</a></li>
<li><a href="ema.php" title="The European Medicines Agency (EMA) (tidligere EMEA) (den europeiske legemiddelkontrollen)">The European Medicines Agency (EMA) (tidligere EMEA) (den europeiske legemiddelkontrollen)</a></li>
<li><a href="patenter.php" title="Patenter (varemerker)">Patenter (varemerker)</a></li>
<li><a href="generiske_legemidler.php" title="Generiske legemidler">Generiske legemidler</a></li>
</ul>

<h3 class="menuheader expandable">Legemiddel-, tobakk-, matvare-, sukker- og kosmetikkindustrien</h3>
<ul class="categoryitems">
<li><a href="legemiddelindustrien.php" title="Legemiddelindustrien (Big pharma)">Legemiddelindustrien (Big pharma)</a></li>
<li><a href="legemiddelindustriforeninger.php" title="Legemiddelindustriforeninger">Legemiddelindustriforeninger</a></li>
<li><a href="matvareindustrien_helsekost_versus_junkfood.php" title="Matvareindustrien (helsekost versus junkfood">Matvareindustrien (helsekost versus junk food) (Big Food)</a></li>
<li><a href="alternativ_behandling.php" title="Alternativ behandling (alternativ medisin)">Alternativ behandling (alternativ medisin)</a></li>
<li><a href="sukkerindustrien_big_sugar.php" title="Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)">Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)</a></li>
character "<" is the first character of a delimiter but occurred as data
Line: 3512, Col: 81
…p" title="Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)">Sukkerin…
end tag for element "a" which is not open
Line: 3512, Col: 174
…ngsmidler)">Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)</a></li>
<li><a href="kosmetikkindustrien.php" title="Kosmetikkindustrien">Kosmetikkindustrien</a></li>
<li><a href="tobakksindustrien.php" title="Tobakksindustrien (Big Tobacco)">Tobakksindustrien (Big Tobacco)</a></li>
<li><a href="vapenindustrien.php" title="Våpenindustrien">Våpenindustrien</a></li>
</ul>

<h3 class="menuheader expandable">Legemiddelforskrivning, feilmedisinering, feilbehandlinger og bivirkninger</h3>
<ul class="categoryitems">
<li><a href="feilmedisineringer_og_feilbehandlinger.php" title="Feilmedisineringer og feilbehandlinger (medisinske feil)">Feilmedisineringer og feilbehandlinger (medisinske feil)</a></li>
<li><a href="diagnostisering_feildiagnostisering_og_pasientsikkerhet.php" title="Diagnostisering, feildiagnostisering, overdiagnostisering og pasientsikkerhet">Diagnostisering, feildiagnostisering, overdiagnostisering og pasientsikkerhet</a></li>
<li><a href="legemiddel_og_annen_substansavhengighet.php" title="Legemiddelavhengighet og annen substansavhengighet">Legemiddelavhengighet og annen substansavhengighet</a></li>
<li><a href="bivirkninger_og_bivirkningsovervakning.php" title="Bivirkninger og bivirkningsoverv&aring;kning">Bivirkninger og bivirkningsovervåkning</a></li>
<li><a href="retningslinjer_og_veiledere.php" title="Retningslinjer og veiledere">Retningslinjer og veiledere</a></li>
<li><a href="legemiddelforskrivning.php" title="Legemiddelforskrivning (feilforskrivning, overmedisinering, deforskrivning (seponering)">Legemiddelforskrivning (feilforskrivning, overmedisinering, deforskrivning (seponering)</a>
<li><a href="apoteker.php" title="Apoteker (apotekforeninger)">Apoteker (apotekforeninger)</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3526, Col: 4
<li><a href="apoteker.php" title="Apoteker (apotekforeninger)">Apoteker (apotek…
<li><a href="legemiddelnavn_som_arsak_til_feilmedisinering.php" title="Legemiddelnavn som &aring;rsak til feilmedisinering">Legemiddelnavn som årsak til feilmedisinering</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3527, Col: 4
<li><a href="legemiddelnavn_som_arsak_til_feilmedisinering.php" title="Legemidd…
<li><a href="bivirkninger_symptomer_og_sykdommer.php" title="Bivirkninger symptomer og sykdommer">Bivirkninger, symptomer og sykdommer</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3528, Col: 4
<li><a href="bivirkninger_symptomer_og_sykdommer.php" title="Bivirkninger sympt…
<li><a href="bivirkninger_organskader.php" title="Bivirkninger (legemiddelinduserte organskader og sykdommer)">Bivirkninger (legemiddelinduserte organskader og sykdommer)</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3529, Col: 4
<li><a href="bivirkninger_organskader.php" title="Bivirkninger (legemiddelindus…
<li><a href="fosterskader_legemiddelrelaterte.php" title="Fosterskader (legemiddelinduserte)">Fosterskader (legemiddelinduserte)</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3530, Col: 4
<li><a href="fosterskader_legemiddelrelaterte.php" title="Fosterskader (legemid…
<li><a href="legemiddelindusert_kreft_og_andre_typer_celleskader.php" title="Legemiddelindusert kreft og andre typer celleskader">Legemiddelindusert kreft og andre typer celleskader</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3531, Col: 4
<li><a href="legemiddelindusert_kreft_og_andre_typer_celleskader.php" title="Le…
<li><a href="ct_mr_ultrasonografi_rontgen_kontrastmidler.php" title="Computertomografi (CT), magnetisk resonanstomografi (MR), positronemisjonstomografi (PET), ultrasonografi (ultralyd), kontrastmidler etc.">Computertomografi (CT), magnetisk resonanstomografi (MR), ultrasonografi (ultralyd), røntgen, kontrastmidler etc. </a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3532, Col: 4
<li><a href="ct_mr_ultrasonografi_rontgen_kontrastmidler.php" title="Computerto…
<li><a href="medisinsk_utstyr.php" title="Medisinsk utstyr">Medisinsk utstyr</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3533, Col: 4
<li><a href="medisinsk_utstyr.php" title="Medisinsk utstyr">Medisinsk utstyr</a…
</ul>
end tag for "li" omitted, but OMITTAG NO was specified
Line: 3534, Col: 5
</ul>
<h3 class="menuheader expandable">Sykdommer, levealder og dødsårsaker</h3>
<ul class="categoryitems">
<li><a href="sykelighet_uforhet_og_trygd.php" title="Sykelighet, sykefravær, uførhet og trygd">Sykelighet, sykefravær, uførhet og trygd</a></li>
<li><a href="dodstall_dodsattester_og_dodsstatistikk.php" title="D&oslash;dstall, d&oslash;dsattester og d&oslash;dsstatistikk">Dødstall, dødsattester og dødsstatistikk</a></li>
<li><a href="levealder_og_dodsorsaker.php" title="Levealder og d&oslash;ds&aring;rsaker">Levealder og dødsårsaker</a></li>
<li><a href="obduksjoner_dodstall_og_dodsarsaker.php" title="Obduksjoner, d&oslash;dstsall og d&oslash;ds&aring;rsaker">Obduksjoner, dødstall og dødsårsaker (- Dødsårsak: ukjent.)</a></li>
<li><a href="organdonasjoner_og_transplantasjoner.php" title="Organdonasjoner og transplantasjoner">Organdonasjoner og transplantasjoner</a></li>
<li><a href="barnevern_omsorgssvikt_barnemishandling_og_barnedrap.php" title="Barnevern, omsorgssvikt, barnemishandling og barnedrap">Barnevern, omsorgssvikt, barnemishandling og barnedrap</a></li>
</ul>

<h3 class="menuheader expandable">Idéutvikling, kreativitet, gründervirksomhet etc.</h3>
<ul class="categoryitems">
<li><a href="ideutvikling_kreativitet_og_grundervirksomhet.php" title="Idéutvikling, kreativitet, gründervirksomhet etc.">Idéutvikling, kreativitet, gründervirksomhet etc.</a></li>
<li><a href="innovasjon.php" title="Innovasjon">Innovasjon</a></li>
<li><a href="patenter.php" title="Patenter (varemerker)">Patenter (varemerker)</a></li>
<li><a href="lykke_happiness.php" title="Lykke (Happiness)">Lykke (Happiness)</a></li>
<li><a href="tid.php" title="Time (Time)">Tid (Time)</a></li>
</ul>

<h3 class="menuheader expandable">Bank, børs, eiendom, forsikring, skatt og finans</h3>
<ul class="categoryitems">
<li><a href="bank_bors_og_finans.php" title="Bank, b&oslash;rs og finans">Bank, børs og finans</a></li>
<li><a href="finanstilsynet.php" title="Finanstilsynet (tidligere Kredittilsynet)">Finanstilsynet (tidligere Kredittilsynet)</a></li>
<li><a href="meglere.php" title="Meglere (eiendommer, aksjer...)">Meglere (eiendommer, aksjer...)</a></li>
<li><a href="forsikring.php" title="Forsikring">Forsikring</a></li>
<li><a href="skatt_skattesvindel_og_skattemyndigheter.php" title="Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)">Skatt, skattesvindel (trygdesvindel) og skattemyndigheter (skatteparadiser)</a></li>
</ul>

<h3 class="menuheader expandable">Gjeldsproblemer, fattigdom, miljø og globalisering</h3>
<ul class="categoryitems">
<li><a href="gjeldsproblemer_og_losninger.php" title="Gjeldsproblemer, gjeldsoffer og løsninger">Gjeldsproblemer, gjeldsoffer og løsninger</a></li>
<li><a href="fattigdom_fordelingspolitikk_og_rikdom.php" title="Fattigdom, fordelingspolitikk (bistand) og rikdom">Fattigdom, fordelingspolitikk (bistand) og rikdom</a></li>
<li><a href="arbeidsmiljo_yrkesskader_og_arbeidsrett.php" title="Arbeidsmilj&oslash;, yrkesskader og arbeidsrett">Arbeidsmiljø, yrkesskader og arbeidsrett (arbeidstilsynet)</a></li>
<li><a href="miljo_og_helse.php" title="Milj&oslash; og helse">Miljø og helse</a></li>
<li><a href="miljo_og_legemiddel.php" title="Milj&oslash; og legemiddel">Miljø og legemiddel</a></li>
<li><a href="klima_miljo_og_globalisering.php" title="Klima, miljø og globalisering">Klima, miljø og globalisering</a></li>
</ul>

<h3 class="menuheader expandable">Makt og demokrati</h3>
<ul class="categoryitems">
<li><a href="makt_og_demokratiutredningen.php" title="Makt og demokratiutredningen">Makt og demokratiutredningen</a></li>
<li><a href="lobbyisme.php" title="Lobbyisme">Lobbyisme</a></li>
<li><a href="politikk_politikere_og_troverdighet.php" title="Politikk, politikere og troverdighet">Politikk, politikere og troverdighet</a></li>
<li><a href="ledelse_lederlonninger.php" title="Ledelse, lederl&oslash;nninger etc.">Ledelse, lederlønninger, pensjoner  etc.</a></li>
<li><a href="etikk_butikk_politikk_veldedighet_og_interessekonflikter.php" title="Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter">Etikk, butikk, grådighet, politikk, veldedighet og interessekonflikter</a></li>
<li><a href="informasjon_versus_kunnskap_og_makt_kommersialisering_og_monopolisering_av_kunnskap.php" title="Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)">Informasjon versus kunnskap og makt (kommersialisering og monopolisering av kunnskap)</a></li>
<li><a href="hvem_lyver_om_irak.php" title="Hvem lyver om Irak?">Hvem lyver om Irak?</a></li>
</ul>

<h3 class="menuheader expandable">Løgn, pisspreik (bullshit) eller sannhet? (Løgn i norske rettssaler)</h3>
<ul class="categoryitems">
<li><a href="logn_pisspreik_eller_sannhet.php" title="Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)">Løgn, pisspreik (bullshit) eller sannhet? (Løgn i norske rettssaler)</a></li>
<li><a href="ondskapens_filosofi_rule_by_nobody.php" title="Ondskapens filosofi (“rule by nobody”)">Ondskapens filosofi (“rule by nobody”)</a></li>
<li><a href="sakkyndige_legers_integritet_partiskhet_og_habilitet.php" title="Sakkyndige legers integritet, partiskhet og habilitet versus l&oslash;gn i rettssalen">Sakkyndige legers integritet, partiskhet og habilitet versus løgn i rettssalen (sakkyndighet)</a></li>
</ul>

<h3 class="menuheader expandable">Lover og forskrifter</h3>
<ul class="categoryitems">
<li><a href="lover_lovdata_og_rettssikkerhet.php" title="Lover (lovdata.no)">Lover (lovdata.no) og rettssikkerhet</a></li>
<li><a href="advokatbladet.php" title="Advokatbladet og Domstolmagasinet Rett på sak"></a></li>
</ul>

<h3 class="menuheader expandable">Konfliktløsning</h3>
<ul class="categoryitems">
<li><a href="konfliktradet.php" title="Konfliktr&aring;det">Konfliktrådet</a></li>
<li><a href="forliksradene_forliksklager_innkassoklagenemnda_post_og_teletilsynet.php" title="Forliksr&aring;dene, forliksklager, Innkassoklagenemnda, Brukerklagenemnda, og Post- og teletilsynet (PT)">Forliksrådene, forliks-klager, Innkassoklage-nemnda, Brukerklage-nemnda, og Post- og teletilsynet (PT)</a></li>
</ul>

<h3 class="menuheader expandable">Anmeldelser, påtale, håndhevelse, etterforskning osv.</h3>
<ul class="categoryitems">
<li><a href="politiet_etterforskning_politianmeldelser_osv.php" title="Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)">Politiet, etterforskning, politianmeldelser (Spesialenheten for politisaker)</a></li>
<li><a href="okokrim.php" title="&Oslash;kokrim">Økokrim (økonomisk kriminalitet / miljøkriminalitet)</a></li>
<li><a href="kripos.php" title="Kripos">Kripos</a></li>
<li><a href="politiets_sikkerhetstjeneste_pst.php" title="Politiets sikkerhetstjeneste (PST)">Politiets sikkerhetstjeneste (PST)</a></li>
<li><a href="riksadvokaten.php" title="Riksadvokaten - Statsadvokatene (Den høyere påtalemyndighet)">Riksadvokaten - Statsadvokatene (Den høyere påtalemyndighet)</a></li>
<li><a href="regjeringsadvokaten.php" title="Regjeringsadvokaten (statens advokatkontor i sivile saker)">Regjeringsadvokaten (statens advokatkontor i sivile saker)</a></li>
<li><a href="finanstilsynet.php" title="Finanstilsynet (tidligere Kredittilsynet)">Finanstilsynet (tidligere Kredittilsynet)</a></li>
<li><a href="riksrevisjonen.php" title="Riksrevisjonen">Riksrevisjonen</a></li>
<li><a href="havarikommisjoner.php" title="Havarikommisjoner">Havarikommisjoner (undersøkelseskommisjoner)</a></li>
<li><a href="konkurransetilsynet.php" title="Konkurransetilsynet">Konkurransetilsynet</a></li>
<li><a href="stiftelsestilsynet_lotteri.php" title="Stiftelsestilsynet (Lotteri- og stiftelsestilsynet)">Stiftelsestilsynet (Lotteri- og stiftelsestilsynet)</a></li>
</ul>

<h3 class="menuheader expandable">Rettssakers forløp</h3>
<ul class="categoryitems">
<li><a href="soksmol.php" title="S&oslash;ksm&aring;l">Søksmål</a></li>
<li><a href="sivilsaker.php" title="Sivilsaker (rettssikkerhet)">Sivilsaker (rettssikkerhet)</a></li>
<li><a href="advokater.php" title="Advokater (rettshjelp)">Advokater (rettshjelp) (mintankesmie.no)</a></li>
<li><a href="sakkyndige_legers_integritet_partiskhet_og_habilitet.php" title="Sakkyndige legers integritet, partiskhet og habilitet versus l&oslash;gn i rettssalen">Sakkyndige legers integritet, partiskhet og habilitet versus løgn i rettssalen (sakkyndighet)</a></li>
<li><a href="prosedyre.php" title="Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)">Prosedyre (rettssaker) (- Vår prosessordning er i det alt vesentlige basert på muntlighet)</a></li>
<li><a href="dommere_og_domstoler.php" title="Dommere og domstoler">Dommere og domstoler</a></li>
<li><a href="saksomkostninger_menigmanns_ruin.php" title="Saksomkostninger (menigmanns ruin) (sakskostnader)">Saksomkostninger (menigmanns ruin) (sakskostnader)</a></li>
<li><a href="anke.php" title="Anke">Anke</a></li>
</ul>

<h3 class="menuheader expandable">Manglende dekonstruksjon og rettssikkerhet innen rettsvesenet</h3>
<ul class="categoryitems">
<li><a href="dekonstruksjon_og_rettssikkerhet.php" title="Dekonstruksjon og rettssikkerhet">Dekonstruksjon og rettssikkerhet</a></li>
<li><a href="justismord.php" title="Justismord">Justismord (og rettssikkerhet)</a></li>
<li><a href="sakkyndige_legers_integritet_partiskhet_og_habilitet.php" title="Sakkyndige legers integritet, partiskhet og habilitet versus l&oslash;gn i rettssalen">Sakkyndige legers integritet, partiskhet og habilitet versus løgn i rettssalen (sakkyndighet)</a></li>
<li><a href="saksomkostninger_menigmanns_ruin.php" title="Saksomkostninger (menigmanns ruin) (sakskostnader)">Saksomkostninger (menigmanns ruin) (sakskostnader)</a></li>
<li><a href="amerikanske_tilstander.php" title="Amerikanske tilstander">Amerikanske tilstander</a></li>
<li><a href="gruppesoksmol.php" title="Gruppes&oslash;ksm&aring;l">Gruppesøksmål</a></li>
<li><a href="utlegg_tvangsinndrivelse_av_pengekrav.php" title="Utlegg (tvangsinndrivelse av pengekrav)">Utlegg (tvangsinndrivelse av pengekrav)</a></li>
<li><a href="gjeldsproblemer_og_losninger.php" title="Gjeldsproblemer, gjeldsoffer og løsninger">Gjeldsproblemer, gjeldsoffer og løsninger</a></li>
</ul>

<h3 class="menuheader expandable">Manglende kvalitet innen rettsvesenet</h3>
<ul class="categoryitems">
<li><a href="sakkyndige_legers_integritet_partiskhet_og_habilitet.php" title="Sakkyndige legers integritet, partiskhet og habilitet versus l&oslash;gn i rettssalen">Sakkyndige legers integritet, partiskhet og habilitet versus løgn i rettssalen (sakkyndighet)</a></li>
<li><a href="opptak_ved_politiavhor_og_i_retten_domstolene.php" title="Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) ">Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) </a></li>
<li><a href="klage_pa_dommere_logn_sakkyndighet_osv.php" title="Klage p&aring; dommere, l&oslash;gn, sakkyndighet osv.">Klage på dommere, løgn, sakkyndighet osv.</a></li>
</ul>

<h3 class="menuheader expandable">Sivilsaker</h3>
<ul class="categoryitems">
<li><a href="sivilsaker.php" title="Sivilsaker (rettssikkerhet)">Sivilsaker (rettssikkerhet)</a></li>
<li><a href="opptak_ved_politiavhor_og_i_retten_domstolene.php" title="Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) ">Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) </a></li>
<li><a href="saksomkostninger_menigmanns_ruin.php" title="Saksomkostninger (menigmanns ruin) (sakskostnader)">Saksomkostninger (menigmanns ruin) (sakskostnader)</a></li>
<li><a href="gjeldsproblemer_og_losninger.php" title="Gjeldsproblemer, gjeldsoffer og løsninger">Gjeldsproblemer, gjeldsoffer og løsninger</a></li>
</ul>

<h3 class="menuheader expandable">Straffesaker (fengselsstraff)</h3>
<ul class="categoryitems">
<li><a href="straffesaker.php" title="Straffesaker (fengselsstraff)">Straffesaker (fengselsstraff)</a></li>
<li><a href="opptak_ved_politiavhor_og_i_retten_domstolene.php" title="Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) ">Opptak (lyd- og billedopptak) ved politiavhør og i retten (domstolene, sakkyndige etc.) </a></li>
<li><a href="den_rettsmedisinske_kommisjon.php" title="Den rettsmedisinske kommisjon (DRK)">Den rettsmedisinske kommisjon (DRK)</a></li>
<li><a href="kommisjonen_for_gjenopptakelse_av_straffesaker.php" title="Kommisjonen for gjenopptakelse av straffesaker Gjenopptakelseskommisjonen">Kommisjonen for gjenopptakelse av straffesaker (Justismordkommisjonen)</a></li>
<li><a href="benadninger.php" title="Benådning av forbrytere (søknader om benådning)">Benådning av forbrytere (søknader om benådning)</a></li>
</ul>

<h3 class="menuheader expandable">Diverse typer erstatningsordninger</h3>
<ul class="categoryitems">
<li><a href="legemiddelerstatninger.php" title="Legemiddelerstatninger">Legemiddelerstatninger (søksmål)</a></li>
<li><a href="norsk_pasientskadeerstatning.php" title="Norsk Pasientskadeerstatning (NPE)">Norsk Pasientskade-erstatning (NPE)</a></li>
<li><a href="diverse_skadeerstatninger.php" title="Diverse skadeerstatninger (skadeserstatninger)">Diverse skadeerstatninger (skadeserstatninger)</a></li>
<li><a href="voldsoffererstatning.php" title="Voldsoffererstatning (vold)">Voldsoffererstatning (vold)</a></li>
<li><a href="rettferdsvederlag.php" title="Rettferdsvederlag (Stortingets rettferdsvederlagsordning) (tidligere billighetserstatning)">Rettferdsvederlag (Stortingets rettferdsvederlagsordning) (tidligere billighetserstatning)</a></li>
<li><a href="stiftelsen_rettferd_for_taperne.php" title="Stiftelsen Rettferd for taperne">Stiftelsen Rettferd for taperne</a></li>
<li><a href="farskapstester.php" title="Farskapstester (farskapssaker)">Farskapstester (farskapssaker)</a></li>
</ul>

<h3 class="menuheader expandable">Diverse legemidler, behandlinger, bivirkninger, symptomer etc.</h3>
<ul class="categoryitems">
<li><a href="accutane.php" title="Accutane">Accutane</a></li>
<li><a href="adhd.php" title="ADHD">ADHD</a></li>
<li><a href="alkohol.php" title="Alkohol">Alkohol</a></li>
<li><a href="allergi.php" title="Allergi (allergier)">Allergi (allergier)</a></li>
<li><a href="alzheimer_og_andre_arsaker_til_demens.php" title="Alzheimer og andre &aring;rsaker til demens">Alzheimer og andre årsaker til demens</a></li>
<li><a href="ambulansetjenester.php" title="Ambulansetjenester">Ambulansetjenester</a></li>
<li><a href="angrepiller_abort_etc.php" title="Angrepiller, abort etc.">Angrepiller, abort etc.</a></li>
<li><a href="antibiotika.php" title="Antibiotika">Antibiotika (tarmbakterier, probiotika, mikrobiota etc.) (Dysbiose; dysbiosis (also called dysbacteriosis (dysbakteriose))</a></li>
<li><a href="antidepressiva_deprimert_eller_stresset.php" title="Antidepressiva - deprimert, litt trist, angst, stresset eller utbrent?">Antidepressiva - deprimert, litt trist, angst, stresset eller utbrent?</a></li>
<li><a href="antidepressiva_ssri_termostat.php" title="Antidepressiva (forhøyet kroppstemperatur (termostat))">Antidepressiva (forhøyet kroppstemperatur (termostat))</a></li>
<li><a href="antidepressiva_nytteverdi.php" title="Antidepressiva (nytteverdi)">Antidepressiva (nytteverdi)</a></li>
<li><a href="antidepressiva_rem_sovn.php" title="Antidepressiva (REM-s&oslash;vn)">Antidepressiva (REM-søvn)</a></li>
<li><a href="antidepressiva_ssri_oyesykdommer.php" title="Antidepressiva (øyesykdommer)">Antidepressiva (øyesykdommer)</a></li>
<li><a href="antidepressiva_soksmal.php" title="Antidepressiva - s&oslash;ksm&aring;l">Antidepressiva - søksmål</a></li>
<li><a href="antidepressiva_ssri.php" title="Antidepressiva">Antidepressiva (SSRI)</a></li>
<li><a href="antidepressiva_ssri_oyesykdommer.php" title="Antidepressiva (øyesyksommer)">Antidepressiva (øyesyksommer)</a></li>
<li><a href="antidepressiva_ssri_selvmord.php" title="Antidepressiva (SSRI-selvmord)">Antidepressiva (SSRI-selvmord)</a></li>
<li><a href="diskriminering_legemiddelbehandlinger_utviklingshemming_utfordrende_atferd.php" title="Diskriminering, feilmedisineringer hos mennesker med utviklingshemming og utfordrende atferd (psykofarmaka; antidepressiva, antipsykotika, sovemedisiner) etc.">Diskriminering, feilmedisineringer hos mennesker med utviklingshemming og utfordrende atferd (psykofarmaka; antidepressiva, antipsykotika, sovemedisiner) etc.</a></li>
<li><a href="rus_forgiftninger_overdoser_og_selvmord.php" title="Rus, forgiftninger, overdoser og selvmord">Rus, forgiftninger, overdoser og selvmord</a></li>
<li><a href="antidepressiva_logn_pisspreik_eller_sannhet.php" title="Antidepressiva   Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler)">Antidepressiva   Løgn, pisspreik (bullshit) eller sannhet? (Løgn i norske rettssaler)</a></li>
<li><a href="serotonin_i_hjerne_og_blod.php" title="Serotonin i hjerne og blod">Serotonin i hjerne og blod</a></li>
<li><a href="serotonin_syndrom_kramper_parkinsonisme_osv.php" title="Serotonin syndrom (SS), kramper, parkinsonisme osv. (forhøyet kroppstemperatur)">Serotonin syndrom (SS), kramper, parkinsonisme osv. (forhøyet kroppstemperatur)</a></li>
<li><a href="antipsykotika.php" title="Antipsykotika">Antipsykotika</a></li>
<li><a href="aricept.php" title="Aricept (donepezil)">Aricept (donepezil)</a></li>
<li><a href="astmalegemidler.php" title="Astmalegemidler">Astmalegemidler</a></li>
<li><a href="benskjorhet.php" title="Benskj&oslash;rhet (osteoporose)">Benskjørhet (osteoporose)</a></li>
<li><a href="blodtrykkslegemidler.php" title="Blodtrykksmedisiner (blodtrykkslegemidler), blodsykdommer etc.">Blodtrykksmedisiner (blodtrykkslegemidler), blodsykdommer etc.</a></li>
<li><a href="hofteproteser_asr_boneloc.php" title="Hofteproteser (Boneloc, ASR etc.)">Hofteproteser (Boneloc, ASR etc.)</a></li>
<li><a href="celebra_celebrex.php" title="Celebra (Celebrex)">Celebra (Celebrex)</a></li>
<li><a href="cipralex.php" title="Cipralex (Lexapro) (escitalopram) - Cipramil (Celexa) (cipramil) (citalopram) - H. Lundbeck A/S">Cipralex (Lexapro) (escitalopram) - Cipramil (Celexa) (cipramil) (citalopram) - H. Lundbeck A/S</a></li>
<li><a href="cymbalta.php" title="Cymbalta (duloxetine hydrochloride)">Cymbalta (duloxetine hydrochloride)</a></li>
<li><a href="diabetes.php" title="Diabetes">Diabetes</a></li>
<li><a href="doping.php" title="Doping">Doping</a></li>
<li><a href="ecstasy.php" title="Ecstasy (MDMA - 3,4-methylenedioxymethamphetamine)">Ecstasy (MDMA - 3,4-methylenedioxy- methamphetamine)</a></li>
<li><a href="efexor_effexor_venlafaxine.php" title="Efexor / Effexor (venlafaxine)">Efexor / Effexor (venlafaxine)</a></li>
<li><a href="elektrosjokk.php" title="Elektrosjokkbehandling (ECT), elektrosjokk, transkranial likestrømsstimulering (tDCS) etc.">Elektrosjokkbehandling (ECT), elektrosjokk, transkranial likestrømsstimulering (tDCS) etc.</a></li>
<li><a href="epilepsi_og_legemidler.php" title="Epilepsi og legemidler">Epilepsi og legemidler</a></li>
<li><a href="eprex.php" title="Eprex (epoetin)">Eprex (epoetin)</a></li>
<li><a href="glukosamin.php" title="Glukosamin">Glukosamin (giktmedisin)</a></li>
<li><a href="heroin.php" title="Heroin (diacetylmorphine)">Heroin (diacetylmorphine)</a></li>
<li><a href="hiv_aids.php" title="Hiv Aids">HIV/AIDS</a></li>
<li><a href="hjernen.php" title="Hjernen">Hjernen</a></li>
<li><a href="hodepine.php" title="Hodepine">Hodepine</a></li>
<li><a href="hormonterapi.php" title="Hormonterapi (HRT-behandling) (Hormon Replacement Therapy)">Hormonterapi (HRT-behandling) (Hormon Replacement Therapy)</a></li>
<li><a href="hostemedisiner.php" title="Hostemedisiner">Hostemedisiner</a></li>
<li><a href="hypothyreose_og_andre_thyreoideasykdommer.php" title="Hypo- og hyperthyreose, tyrotoksikose og andre thyreoideasykdommer">Hypo- og hyperthyreose, tyrotoksikose og andre thyreoideasykdommer</a></li>
<li><a href="influensavaksiner.php" title="Influensavaksiner">Influensavaksiner</a></li>
<li><a href="ketek.php" title="Ketek (telithromycin)">Ketek (telithromycin)</a></li>
<li><a href="kreft.php" title="Kreft">Kreft</a></li>
<li><a href="kronisk_tretthetssyndrom.php" title="Kronisk tretthetssyndrom/myalgisk encefalopati (CFS/ME)">Kronisk tretthetssyndrom/Myalgisk encefalopati (CFS/ME)</a></li>
<li><a href="kvikksolvforgiftninger.php" title="Kvikksølvforgiftninger (kvikksølv-saken - tannlegeassistenter)">Kvikksølvforgiftninger (kvikksølv-saken - tannlegeassistenter)</a></li>
<li><a href="litium.php" title="Litium (Lithium)">Litium (Lithium)</a></li>
<li><a href="cannabis.php" title="Cannabis (marihuana hasj, pot etc.) (Big Marijuana)">Cannabis (marihuana hasj, pot etc.) (Big Marijuana)</a></li>
<li><a href="metadon.php" title="Metadon (methadone hydrochloride) - Subotex (buprenorfin) (Buprenorphine)">Metadon (methadone hydrochloride) - Subotex (buprenorfin) (Buprenorphine)</a></li>
<li><a href="migrene.php" title="Migrene (legemidler)">Migrene (legemidler)</a></li>
<li><a href="mitochondria.php" title="Mitochondria (mitokondrie) (mitokondriesykdommer) (mitokondrielle sykdommer)">Mitochondria (mitokondrie) (mitokondriesykdommer) (mitokondrielle sykdommer)</a></li>
<li><a href="nanoteknologi.php" title="Nanoteknologi (nanopartikler)">Nanoteknologi (nanopartikler)</a></li>
<li><a href="neurontin.php" title="Neurontin (gabapentin)">Neurontin (gabapentin)</a></li>
<li><a href="otrivin.php" title="Otrivin (xylometazoline hydrochloride) (nesedråper og nesespray)">Otrivin (xylometazoline hydrochloride) (nesedråper og nesespray)</a></li>
<li><a href="oxycontin.php" title="OxyContin (oxycodone hydrochloride) (Oksykodon)">OxyContin (oxycodone hydrochloride) (Oksykodon)</a></li>
<li><a href="paracetamol.php" title="Paracetamol (acetaminophen) og diverse andre smertestillende midler">Paracetamol (acetaminophen) og diverse andre smertestillende midler</a></li>
<li><a href="parkinsonlegemidler.php" title="Parkinsonlegemidler (Parkinsons sykdom)">Parkinsonlegemidler (Parkinsons sykdom)</a></li>
<li><a href="p_piller.php" title="P-piller">P-piller</a></li>
<li><a href="plavix.php" title="Plavix (clopidogrel bisulfate)">Plavix (clopidogrel bisulfate)</a></li>
<li><a href="protonpumpehemmere_syrehemmende.php" title="Protonpumpehemmere">Protonpumpehemmere (proton pump inhibitors (PPIs) (syrepumpehemmere) (magesyrehemmere) (syrenøytraliserende midler (antacida))</a></li>
<li><a href="prozac.php" title="Prozac (fluoxetine)">Prozac (fluoxetine)</a></li>
<li><a href="redux.php" title="Redux (dexfenfluramine)">Redux (dexfenfluramine)</a></li>
<li><a href="remicade_humira_enbrel.php" title="TNF-alfa-hemmere (Remicade (infliximab/infliksimab), Humira (adalimumab), Enbrel (etanercept) etc.)">TNF-alfa-hemmere (Remicade (infliximab/infliksimab), Humira (adalimumab), Enbrel (etanercept) etc.)</a></li>
<li><a href="risperdal.php" title="Risperdal (risperidone)">Risperdal (risperidone)</a></li>
<li><a href="selvmord.php" title="Selvmord">Selvmord</a></li>
<li><a href="seroxat_ssri.php" title="Seroxat (Paxil) (paroxetine; paroksetin) (SSRI)">Seroxat (Paxil) (paroxetine; paroksetin) (SSRI)</a></li>
<li><a href="sifrol.php" title="Sifrol (pramipexol)">Sifrol (pramipexol)</a></li>
<li><a href="smon.php" title="SMON (oxikinolin)">SMON (oxikinolin)</a></li>
<li><a href="somadril.php" title="Somadril (karisoprodol) (CARISOPRODOL)">Somadril (karisoprodol) (CARISOPRODOL)</a></li>
<li><a href="sovemidler_og_beroligende_midler.php" title="Sovemidler (sovemedisiner) og beroligende midler">Sovemidler (sovemedisiner) og beroligende midler</a></li>
<li><a href="sovn.php" title="S&oslash;vn">Søvn</a></li>
<li><a href="spilleavhengighet.php" title="Spilleavhengighet (spilleavhengige/problemspillere)">Spilleavhengighet (spilleavhengige/problemspillere)</a></li>
<li><a href="statiner_mot_hoyt_kolesterol.php" title="Statiner etc. (mot høyt kolesterol)">Statiner etc. (mot høyt kolesterol)</a></li>
<li><a href="tamiflu_influensabehandling.php" title="Tamiflu (oseltamivir), Relenza (zanamivir) etc. (influensabehandling)">Tamiflu (oseltamivir), Relenza (zanamivir) etc. (influensabehandling)</a></li>
<li><a href="thalidomide.php" title="Thalidomide (Thalidomid) informasjon vs kunnskap og visdom - hvem visste hva?">Thalidomide (Thalidomid) informasjon vs kunnskap og visdom - hvem visste hva?</a></li>
<li><a href="trafikk_trafikkulykker.php" title="Trafikk (trafikkulykker) (Veg- og trafikkinformasjon etc.)">Trafikk (trafikkulykker) (Veg- og trafikkinformasjon etc.)</a></li>
<li><a href="trasylol.php" title="Trasylol (aprotinin injection)">Trasylol (aprotinin injection)</a></li>
<li><a href="vaksiner.php" title="Vaksiner">Vaksiner</a></li>
<li><a href="vioxx_og_andre_smertestillende.php" title="Vioxx (rofecoxib COX-2) og andre smertestillende">Vioxx (rofecoxib COX-2) og andre smertestillende</a></li>
<li><a href="vioxx_historien_bak.php" title="Vioxx (historien bak)">Vioxx (historien bak)</a></li>
<li><a href="xanor_xanax.php" title="Xanor (alprazolam)">Xanor (Xanax i USA) (alprazolam)</a></li>
<li><a href="xenical_orlistat.php" title="Xenical (orlistat) (&quot;Alli&quot;)">Xenical (orlistat) ("Alli")</a></li>
<li><a href="zyprexa.php" title="Zyprexa (olanzapine)">Zyprexa (olanzapine)</a></li>
<li><a href="oyesykdommer_oyner_er_sjelens_vindu.php" title="&Oslash;yesykdommer (&oslash;yner er sjelens vindu)">Øyesykdommer (øyner er sjelens vindu)</a></li>
</ul>

</div>
</div></div>
				    </div>
				    <div class="tab2" id="linker">
					  <div><div>
<div class="arrowlistmenu">

<h3 class="menuheader expandable">MinTankesmie.no</h3>
<ul class="categoryitems">
<li><a href="http://www.mintankesmie.no/om_foretaket.php" title="Om foretaket (About)">Om foretaket (About)</a></li>
	    <li><a href="startside.php" title="Sett som startside">Sett som startside</a></li>
		<li><a href="javascript:window.print()" title="Skriv ut">Skriv ut denne siden</a></li>
		<li><a href="mailto:kontakt@mintankesmie.no" title="Kontakt oss">kontakt@mintankesmie.no</a></li>
		</ul>

<h3 class="menuheader expandable">Meteorologi</h3>
<ul class="categoryitems">
		<li><a href="http://www.timeanddate.no/astronomi/vintersolverv" title="Solverv og jevndøgn i Norge ">Solverv og jevndøgn i Norge </a></li>
		<li><a href="http://astronomi.no/kart.php" title="Aktuelle stjernekart, Solens og M&aring;nens oppgang og nedgang">Solens og M&aring;nens oppgang og nedgang (Aktuelle stjernekart)</a></li>
		<li><a href="http://metlex.met.no/wiki/Hovedside" title="Meteorologileksikon">Meteorologileksikon</a></li>
		<li><a href="http://www.yr.no/" title="V&aelig;ret i Norge og utlandet - Yr.no">V&aelig;ret i Norge og utlandet - Yr.no</a></li>
		<li><a href="http://www.nve.no/ismelding" title="Ismelding (for persontrafikk på uregulerte vann)">Ismelding (for persontrafikk på uregulerte vann)</a></li>
		<li><a href="http://www.kystverket.no/default.aspx?did=9864242" title="Ismelding fra Kystverkets istjeneste">Ismelding fra Kystverkets istjeneste</a></li>
		<li><a href="http://www.wmo.int/" title="World Meteorological Organization">World Meteorological Organization</a></li>
		<li><a href="http://cloudappreciationsociety.org/" title="The Cloud Appreciation Society">The Cloud Appreciation Society</a></li>
		<li><a href="http://www.rmets.org/" title="Royal Meteorological Society (RMetS)">Royal Meteorological Society (RMetS)</a></li>
		<li><a href="http://www.ncar.ucar.edu/" title="The National Center for Atmospheric Research">The National Center for Atmospheric Research</a></li>
		</ul>

<h3 class="menuheader expandable">Astronomi</h3>
<ul class="categoryitems">
		<li><a href="http://visual.merriam-webster.com/astronomy/astronomical-observation.php" title="ASTRONOMICAL OBSERVATION">ASTRONOMICAL OBSERVATION (The Visual Dictionary)</a></li>
		<li><a href="http://www.astroshop.eu/" title="Astroshop.eu">Astroshop.eu</a></li>
		<li><a href="http://www.space.com/" title="SPACE.com">SPACE.com</a></li>
		<li><a href="http://teachingwithtelescopes.org/assembly.html" title="the Galileoscope project">the Galileoscope project</a></li>
		<li><a href="http://images.google.com/images?q=solar%20system" title="Solar system (solsystemet)">Solar system (solsystemet)</a></li>
		<li><a href="http://visibleearth.nasa.gov/" title="Visible Earth - Earth's City Lights (NASA)">Visible Earth - Earth's City Lights (NASA)</a></li>
		<li><a href="http://hubblesite.org/" title="Hubble Space Telescope (NASA)">Hubble Space Telescope (NASA)</a></li>
		<li><a href="http://www.nasa.gov/mission_pages/kepler/main/index.html" title="Kepler Telescope (NASA)">Kepler Telescope (NASA)</a></li>
		<li><a href="http://sci.esa.int/science-e/www/object/index.cfm?fobjectid=45984" title="Herschel telescope">Herschel telescope</a></li>
		<li><a href="http://sci.esa.int/science-e/www/area/index.cfm?fareaid=17" title="Planck telescope">Planck telescope</a></li>
		<li><a href="http://www.eso.org/public/norway/" title="European Southern Observatory (ESO)">European Southern Observatory (ESO)</a></li>
		<li><a href="http://www.eso.org/public/teles-instr/vlt/index.html" title="The Very Large Telescope (VLT)">The Very Large Telescope (VLT)</a></li>
		<li><a href="http://astrobiology.nasa.gov/ask-an-astrobiologist/" title="Ask an Astrobiologist (NASA)">Ask an Astrobiologist (NASA)</a></li>
		<li><a href="http://www.worldwidetelescope.org/" title="WorldWide Telescope (WWT)">WorldWide Telescope (WWT)</a></li>
		<li><a href="http://www.telescopes.com/?source=affiliates&amp;bid=303403&amp;aid=CD5495&amp;opt=" title="Binoculars.com">Binoculars.com</a></li>
		<li><a href="http://folk.uio.no/knutjo/" title="Knut J&oslash;rgen R&oslash;ed &Oslash;degaard">Knut J&oslash;rgen R&oslash;ed &Oslash;degaard</a></li>
		<li><a href="http://www.bangirommet.no/pages/news/titansjo.html" title="BANG i rommet.no">BANG i rommet.no</a></li>
		<li><a href="http://www.astro.uio.no/" title="Astrofysisk Institutt">Astrofysisk Institutt</a></li>
		<li><a href="http://www.ted.com/talks/view/id/224" title="Microsoft">Microsoft</a></li>
		<li><a href="http://www.google.com/sky/" title="Google Sky">Google Sky</a></li>
		<li><a href="http://www.nasa.gov/worldbook/earth_worldbook.html" title="Earth">Earth</a></li>
		<li><a href="http://www1.nasa.gov/worldbook/jupiter_worldbook.html" title="Jupiter">Jupiter</a></li>
		<li><a href="http://www.space.com/" title="Space.com ">Space.com </a></li>
		<li><a href="http://www.spacedaily.com/" title="SpaceDaily">SpaceDaily</a></li>
		<li><a href="http://www.nasa.gov/multimedia/imagegallery/image_feature_567.html" title="Crab Nebula ">Crab Nebula</a></li>
		<li><a href="http://www.dagbladet.no/kunnskap/2006/08/24/474822.html" title="Pluto stemt ut av planetrekka">Pluto stemt ut av planetrekka</a></li>
		<li><a href="http://www.aftenposten.no/fakta/innsikt/article2840588.ece" title="Planetshow på kveldshimmelen">Planetshow på kveldshimmelen</a></li>
		<li><a href="http://www.uio.no/publikum/gallerisverdrup/04/don_dixon.html" title="Billedutstilling med Don Dixon, en av verdens mest anerkjente astro-kunstnere">Billedutstilling med Don Dixon, en av verdens mest anerkjente astro-kunstnere</a></li>
		<li><a href="http://www.cosmographica.com/gallery/portfolio/index.html" title="Don Dixon Portfolio">Don Dixon Portfolio</a></li>
		<li><a href="http://www.stellarium.org/" title="Stellarium">Stellarium</a></li>
		<li><a href="http://www.shatters.net/celestia/index.html" title="Celestia">Celestia</a></li> 
		<li><a href="http://www.nrk.no/nyheter/utenriks/1.6371529" title="Vi dro til Månen - og fant Jorden">Vi dro til Månen - og fant Jorden</a></li>
		<li><a href="http://nrk.no/nyheter/1.6372244" title="Nå går det mot lysere tider">Nå går det mot lysere tider</a></li>
		<li><a href="http://www.rb.no/bilde/article3297877.ece?start=1" title="BILDESERIE Vakre perlemorsskyer">BILDESERIE Vakre perlemorsskyer</a></li>
		<li><a href="http://www.colourlovers.com/blog/2008/05/12/colors-of-the-night-sky/" title="Colors Of The Night Sky">Colors Of The Night Sky</a></li>
		<li><a href="http://www.spitzer.caltech.edu/Media/releases/ssc2006-17/" title="The Eternal Life of Stardust Portrayed in New NASA Image">The Eternal Life of Stardust Portrayed in New NASA Image</a></li>
		</ul>

<h3 class="menuheader expandable">Sosiale nettsamfunn</h3>
<ul class="categoryitems">
		<li><a href="http://no.wikipedia.org/wiki/Nettsamfunn">Nettsamfunn (Wikipedia)</a></li>
		<li><a href="https://www.linkedin.com/">LinkedIn</a></li>
		<li><a href="https://twitter.com/">Twitter</a></li>
		<li><a href="https://www.facebook.com/">Facebook</a></li>
		<li><a href="http://instagram.com/">Instagram</a></li>
		<li><a href="http://www.joindiaspora.com/">diaspora </a></li>
		<li><a href="http://www.ning.com/">Ning</a></li>
		<li><a href="http://pinterest.com/">Pinterest</a></li>
		<li><a href="http://www.bebo.com/">Bebo</a></li>
		<li><a href="http://www.digg.com/">Digg</a></li>
		<li><a href="http://www.ubervu.com/">uberVU</a></li>
		<li><a href="http://wakoopa.com/">Wakoopa (software, games...)</a></li>
		<li><a href="http://no.myspace.com/">MySpace</a></li>
		<li><a href="http://www.listal.com/">Listal</a></li>
		</ul>

<h3 class="menuheader expandable">Slektsforskning - arkeologi</h3>
<ul class="categoryitems">
		<li><a href="http://www.arkivverket.no/URN:kb_read" title="Skannede kirkebøker (Digitalarkivet - Arkivverket.no)">Skannede kirkebøker (Digitalarkivet - Arkivverket.no)</a></li>
		<li><a href="http://www.slekt.no/" title="Slekt.no (SLEKT NORGE)">Slekt.no (SLEKT NORGE)</a></li>
		<li><a href="http://www.familylink.com/no/ppc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="FamilyLink.com er en fremragende, rimelig måte å drive slektsforskning på nettet.">FamilyLink.com er en fremragende, rimelig måte å drive slektsforskning på nettet.</a></li>
cannot generate system identifier for general entity "utm_source"
Line: 3862, Col: 74
…k.com/no/ppc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norwa…
reference not terminated by REFC delimiter
Line: 3862, Col: 84
…pc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Co…
reference to external entity in attribute value
Line: 3862, Col: 84
…pc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Co…
cannot generate system identifier for general entity "utm_campaign"
Line: 3862, Col: 96
…nt=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_…
reference not terminated by REFC delimiter
Line: 3862, Col: 108
…632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&…
reference to external entity in attribute value
Line: 3862, Col: 108
…632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&…
cannot generate system identifier for general entity "tr_ad_group"
Line: 3862, Col: 130
…gle&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr…
reference not terminated by REFC delimiter
Line: 3862, Col: 141
…paign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&page…
reference to external entity in attribute value
Line: 3862, Col: 141
…paign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&page…
cannot generate system identifier for general entity "tr_brand"
Line: 3862, Col: 148
…orway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=pp…
reference not terminated by REFC delimiter
Line: 3862, Col: 156
…_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1…
reference to external entity in attribute value
Line: 3862, Col: 156
…_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1…
reference not terminated by REFC delimiter
Line: 3862, Col: 163
…tent&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_cam…
cannot generate system identifier for general entity "ssr"
Line: 3862, Col: 167
…&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id…
reference not terminated by REFC delimiter
Line: 3862, Col: 170
…_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=30…
reference to external entity in attribute value
Line: 3862, Col: 170
…_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=30…
cannot generate system identifier for general entity "pagename"
Line: 3862, Col: 177
…up=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381…
reference not terminated by REFC delimiter
Line: 3862, Col: 185
…&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_i…
reference to external entity in attribute value
Line: 3862, Col: 185
…&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_i…
cannot generate system identifier for general entity "ft"
Line: 3862, Col: 192
…nd=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486…
reference not terminated by REFC delimiter
Line: 3862, Col: 194
…=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637…
reference to external entity in attribute value
Line: 3862, Col: 194
…=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637…
cannot generate system identifier for general entity "tr_camp_id"
Line: 3862, Col: 197
…lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637306…
reference not terminated by REFC delimiter
Line: 3862, Col: 207
…r=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_netwo…
reference to external entity in attribute value
Line: 3862, Col: 207
…r=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_netwo…
cannot generate system identifier for general entity "tr_ag_id"
Line: 3862, Col: 218
…ename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_key…
reference not terminated by REFC delimiter
Line: 3862, Col: 226
…cgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gra…
reference to external entity in attribute value
Line: 3862, Col: 226
…cgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gra…
cannot generate system identifier for general entity "tr_network"
Line: 3862, Col: 239
…amp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_pla…
reference not terminated by REFC delimiter
Line: 3862, Col: 249
…223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www…
reference to external entity in attribute value
Line: 3862, Col: 249
…223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www…
cannot generate system identifier for general entity "tr_keyword"
Line: 3862, Col: 252
…381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.di…
reference not terminated by REFC delimiter
Line: 3862, Col: 262
…id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_m…
reference to external entity in attribute value
Line: 3862, Col: 262
…id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_m…
cannot generate system identifier for general entity "tr_placement"
Line: 3862, Col: 273
…061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&t…
reference not terminated by REFC delimiter
Line: 3862, Col: 285
…rk=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=n…
reference to external entity in attribute value
Line: 3862, Col: 285
…rk=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=n…
cannot generate system identifier for general entity "tr_matchtype"
Line: 3862, Col: 298
…rd=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creati…
reference not terminated by REFC delimiter
Line: 3862, Col: 310
…&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=770836974…
reference to external entity in attribute value
Line: 3862, Col: 310
…&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=770836974…
cannot generate system identifier for general entity "tr_position"
Line: 3862, Col: 312
…r_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421…
reference not terminated by REFC delimiter
Line: 3862, Col: 323
…=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=…
reference to external entity in attribute value
Line: 3862, Col: 323
…=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=…
cannot generate system identifier for general entity "tr_creative"
Line: 3862, Col: 329
…igi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_d…
reference not terminated by REFC delimiter
Line: 3862, Col: 340
…atchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model…
reference to external entity in attribute value
Line: 3862, Col: 340
…atchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model…
cannot generate system identifier for general entity "tr_device"
Line: 3862, Col: 353
…position=none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extensio…
reference not terminated by REFC delimiter
Line: 3862, Col: 362
…none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_…
reference to external entity in attribute value
Line: 3862, Col: 362
…none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_…
cannot generate system identifier for general entity "tr_device_model"
Line: 3862, Col: 365
…e&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_tar…
reference not terminated by REFC delimiter
Line: 3862, Col: 380
…7083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-9698…
reference to external entity in attribute value
Line: 3862, Col: 380
…7083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-9698…
cannot generate system identifier for general entity "tr_extension_id"
Line: 3862, Col: 382
…83697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859…
reference not terminated by REFC delimiter
Line: 3862, Col: 397
…ice=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location…
reference to external entity in attribute value
Line: 3862, Col: 397
…ice=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location…
cannot generate system identifier for general entity "tr_target_id"
Line: 3862, Col: 399
…e=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9…
reference not terminated by REFC delimiter
Line: 3862, Col: 411
…e_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_pl…
reference to external entity in attribute value
Line: 3862, Col: 411
…e_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_pl…
cannot generate system identifier for general entity "tr_location"
Line: 3862, Col: 426
…ension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=…
reference not terminated by REFC delimiter
Line: 3862, Col: 437
…tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyO…
reference to external entity in attribute value
Line: 3862, Col: 437
…tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyO…
cannot generate system identifier for general entity "tr_placement_target"
Line: 3862, Col: 446
…_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCF…
reference not terminated by REFC delimiter
Line: 3862, Col: 465
…r_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" titl…
reference to external entity in attribute value
Line: 3862, Col: 465
…r_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" titl…
cannot generate system identifier for general entity "gclid"
Line: 3862, Col: 467
…location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title=…
reference not terminated by REFC delimiter
Line: 3862, Col: 472
…ion=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="Fami…
reference to external entity in attribute value
Line: 3862, Col: 472
…ion=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="Fami…
general entity "utm_source" not defined and no default entity
Line: 3862, Col: 74
…k.com/no/ppc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norwa…
reference to entity "utm_source" for which no system identifier could be generated
Line: 3862, Col: 84
…pc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Co…
general entity "utm_campaign" not defined and no default entity
Line: 3862, Col: 96
…nt=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_…
reference to entity "utm_campaign" for which no system identifier could be generated
Line: 3862, Col: 108
…632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&…
general entity "tr_ad_group" not defined and no default entity
Line: 3862, Col: 130
…gle&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr…
reference to entity "tr_ad_group" for which no system identifier could be generated
Line: 3862, Col: 141
…paign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&page…
general entity "tr_brand" not defined and no default entity
Line: 3862, Col: 148
…orway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=pp…
reference to entity "tr_brand" for which no system identifier could be generated
Line: 3862, Col: 156
…_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1…
general entity "ssr" not defined and no default entity
Line: 3862, Col: 167
…&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id…
reference to entity "ssr" for which no system identifier could be generated
Line: 3862, Col: 170
…_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=30…
general entity "pagename" not defined and no default entity
Line: 3862, Col: 177
…up=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381…
reference to entity "pagename" for which no system identifier could be generated
Line: 3862, Col: 185
…&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_i…
general entity "ft" not defined and no default entity
Line: 3862, Col: 192
…nd=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486…
reference to entity "ft" for which no system identifier could be generated
Line: 3862, Col: 194
…=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637…
general entity "tr_camp_id" not defined and no default entity
Line: 3862, Col: 197
…lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637306…
reference to entity "tr_camp_id" for which no system identifier could be generated
Line: 3862, Col: 207
…r=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_netwo…
general entity "tr_ag_id" not defined and no default entity
Line: 3862, Col: 218
…ename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_key…
reference to entity "tr_ag_id" for which no system identifier could be generated
Line: 3862, Col: 226
…cgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gra…
general entity "tr_network" not defined and no default entity
Line: 3862, Col: 239
…amp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_pla…
reference to entity "tr_network" for which no system identifier could be generated
Line: 3862, Col: 249
…223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www…
general entity "tr_keyword" not defined and no default entity
Line: 3862, Col: 252
…381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.di…
reference to entity "tr_keyword" for which no system identifier could be generated
Line: 3862, Col: 262
…id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_m…
general entity "tr_placement" not defined and no default entity
Line: 3862, Col: 273
…061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&t…
reference to entity "tr_placement" for which no system identifier could be generated
Line: 3862, Col: 285
…rk=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=n…
general entity "tr_matchtype" not defined and no default entity
Line: 3862, Col: 298
…rd=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creati…
reference to entity "tr_matchtype" for which no system identifier could be generated
Line: 3862, Col: 310
…&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=770836974…
general entity "tr_position" not defined and no default entity
Line: 3862, Col: 312
…r_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421…
reference to entity "tr_position" for which no system identifier could be generated
Line: 3862, Col: 323
…=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=…
general entity "tr_creative" not defined and no default entity
Line: 3862, Col: 329
…igi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_d…
reference to entity "tr_creative" for which no system identifier could be generated
Line: 3862, Col: 340
…atchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model…
general entity "tr_device" not defined and no default entity
Line: 3862, Col: 353
…position=none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extensio…
reference to entity "tr_device" for which no system identifier could be generated
Line: 3862, Col: 362
…none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_…
general entity "tr_device_model" not defined and no default entity
Line: 3862, Col: 365
…e&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_tar…
reference to entity "tr_device_model" for which no system identifier could be generated
Line: 3862, Col: 380
…7083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-9698…
general entity "tr_extension_id" not defined and no default entity
Line: 3862, Col: 382
…83697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859…
reference to entity "tr_extension_id" for which no system identifier could be generated
Line: 3862, Col: 397
…ice=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location…
general entity "tr_target_id" not defined and no default entity
Line: 3862, Col: 399
…e=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9…
reference to entity "tr_target_id" for which no system identifier could be generated
Line: 3862, Col: 411
…e_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_pl…
general entity "tr_location" not defined and no default entity
Line: 3862, Col: 426
…ension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=…
reference to entity "tr_location" for which no system identifier could be generated
Line: 3862, Col: 437
…tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyO…
general entity "tr_placement_target" not defined and no default entity
Line: 3862, Col: 446
…_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCF…
reference to entity "tr_placement_target" for which no system identifier could be generated
Line: 3862, Col: 465
…r_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" titl…
general entity "gclid" not defined and no default entity
Line: 3862, Col: 467
…location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title=…
reference to entity "gclid" for which no system identifier could be generated
Line: 3862, Col: 472
…ion=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="Fami…
		<li><a href="http://www.arkivportalen.no/" title="Arkivportalen - Nasjonal søketjeneste på tvers av arkivinstitusjoners kataloger)">Arkivportalen - Nasjonal søketjeneste på tvers av arkivinstitusjoners kataloger)</a></li> 
		<li><a href="http://www.familysearch.org/" title="Søk etter personer (verden)">Søk etter personer (verden)</a></li> 
		<li><a href="http://www.unimus.no/" title="Universitetsmuseenes arkeologiske samlinger">Universitetsmuseenes arkeologiske samlinger</a></li> 
		<li><a href="http://www.lokalhistorie.no/kilder_litteratur/publ/artikler/lokhist.html" title="Lokalhistorie i Norge ">Lokalhistorie i Norge </a></li> 
		<li><a href="http://www.gamlenaboar.uib.no/hovedmeny_b.htm" title="gamle NABOER (for Vestlandet)">gamle NABOER (for Vestlandet)</a></li> 
		<li><a href="http://www.geni.com/" title="Geni is the world's largest free family tree">Geni is the world's largest free family tree</a></li> 
		<li><a href="http://www.disnorge.no/" title="DIS-Norge - møtested for slektsforskere">DIS-Norge - møtested for slektsforskere</a></li> 
		<li><a href="http://www.disnorge.no/gravminner/index.php" title="Gravminner i Norge - Tilrettelagt av DIS-Norge">Gravminner i Norge - Tilrettelagt av DIS-Norge</a></li> 
		<li><a href="http://www.dagbladet.no/tekstarkiv/pdf.utv.php?pa=A&amp;d=2007-12-26&amp;p=55&amp;read=1" title="Gled deg, slektsforsker! (dagbladet.no 26.12.2007)">Gled deg, slektsforsker! (dagbladet.no)</a></li> 
		<li><a href="http://www.deichmanske-bibliotek.oslo.kommune.no/slektsforskning" title="Slektsforskning (Deichmanske bibliotek)">Slektsforskning (Deichmanske bibliotek)</a></li>
		<li><a href="http://www.sol.no/hobby/slektsforskning/" title="SOL slektsforskning: alt du trenger på én side">SOL slektsforskning: alt du trenger på én side</a></li> 
		<li><a href="http://www.lokalhistorie.no/" title="Norsk lokalhistorisk institutt (NLI)">Norsk lokalhistorisk institutt (NLI)</a></li>
		<li><a href="http://www.lokalhistorie.no/andreland.html" title="(Lokalhistorie i andre land)">(Lokalhistorie i andre land)</a></li>
		</ul>

<h3 class="menuheader expandable">Startsider Norge</h3>
<ul class="categoryitems">
		<li><a href="http://www.sol.no/" title="sol.no">sol.no</a></li>
		<li><a href="http://www.msn.no/" title="msn.no">msn.no</a></li>
		<li><a href="http://yasp.no/" title="yasp.no">yasp.no</a></li>
		<li><a href="http://www.start.no/" title="start.no">start.no</a></li>
		<li><a href="http://www.mylder.no/" title="mylder.no">mylder.no</a></li>
		<li><a href="http://www.allesider.no/" title="allesider.no">allesider.no</a></li>			
		<li><a href="http://www.startsiden.no/" title="startsiden.no">startsiden.no</a></li>
		<li><a href="http://www.kvinneguiden.no/" title="kvinneguiden.no">kvinneguiden.no</a></li>
		<li><a href="http://www.nordnorgesguiden.no/" title="Nordnorgesguiden.no">Nordnorgesguiden.no</a></li>
		</ul>

<h3 class="menuheader expandable">Danmark, Sverige... (Norden), verden</h3>
<ul class="categoryitems">
		<li><a href="http://www.krak.dk/" title="Krak.dk">Krak.dk</a></li>
		<li><a href="http://msn.dk/" title="msn.dk">msn.dk</a></li>
		<li><a href="http://www.Passagen.se/" title="Passagen.se">Passagen.se</a></li>
		<li><a href="http://www.msn.se/" title="msn.se">msn.se</a></li>
		<li><a href="http://mediavejviseren.dk/net/portaler-norden.htm" title="Portaler i Norden">Portaler i Norden</a></li>
		<li><a href="http://mediavejviseren.dk/net/internationale-portaler.htm" title="Internasjonale portaler">Internasjonale portaler</a></li>
		<li><a href="http://sfbay.craigslist.org/about/cities.html" title="craigslist">craigslist</a></li>
		<li><a href="http://dmoz.org/World/Norsk/Data/Internett/P%C3%A5_verdensveven/Portaler_og_startsider/" title="Diverse portaler og startsider">Portaler og startsider</a></li>
		</ul>

<h3 class="menuheader expandable">Association of Virtual Worlds</h3>
<ul class="categoryitems">
		<li><a href="http://www.associationofvirtualworlds.com/publishing_division.php">The Blue Book: A Consumer Guide to Virtual Worlds etc. (Download)</a></li>
		</ul>

<h3 class="menuheader expandable">Data- IT- og internettordbøker (leksikon)</h3>
<ul class="categoryitems">
		<li><a href="http://www.webopedia.com/" title="Webopedia.com (Dictionary - words, phrases and abbreviations - computer and Internet)">Webopedia.com (Dictionary - words, phrases and abbreviations - computer and Internet)</a></li>
		<li><a href="http://whatis.techtarget.com/" title="Slå opp tusener av IT-relaterte ord  - det ledende IT-leksikon (TechTarget - Whatis?com)">Slå opp tusener av IT-relaterte ord  - det ledende IT-leksikon (TechTarget - Whatis?com)</a></li>
		<li><a href="http://www.techweb.com/encyclopedia/;jsessionid=MM55OXZMIRZAQQSNDLOSKH0CJUNN2JVN" title="TechEncyclopedia - More than 20,000 IT terms (TechWeb)">TechEncyclopedia - More than 20,000 IT terms (TechWeb)</a></li>
		</ul>

<h3 class="menuheader expandable">Internett - statistikk</h3>
<ul class="categoryitems">
		<li><a href="http://www.google.com/trends" title="Google Trends">Google Trends</a></li>		
		<li><a href="http://www.languagemonitor.com/Top_Word_Lists.html" title="Top Word Lists (Global Language Monitor) ">Top Word Lists (Global Language Monitor)</a></li>		
		<li><a href="http://learn.wordtracker.com/" title="Internett - mest s&oslash;kte ord">Mest s&oslash;kte ord</a></li>
		<li><a href="http://mediavejviseren.dk/net/internet-trafik-statistik.htm" title="Internet statistik og trafik">Trafikk - statistikk</a></li>				
		<li><a href="http://www.nielsen-netratings.com/" title="Nielsen//NetRatings">Nielsen//NetRatings</a></li>
		<li><a href="http://www.ssb.no/inet/" title="SSB - internettmåling">SSB (internettmåling)</a></li>
		<li><a href="http://www.ssb.no/medie/" title="Norsk mediebarometer">Mediebarometer</a></li>							
		<li><a href="http://www.m-w.com/info/06words.htm" title="Words of the Year 2006">Words of the Year 2006</a></li>
		<li><a href="http://www.ssb.no/emner/10/03/ikt/" title="Informasjonssamfunnet (IKT)">Informasjonssamfunnet (IKT)</a></li>
		</ul>

<h3 class="menuheader expandable">Allmenn - mediestatistikk</h3>
<ul class="categoryitems">
		<li><a href="http://medienorge.uib.no/?cat=lenker&amp;page=norske" title="Allmenn mediestatistikk">- Norske pekere</a></li>	
		<li><a href="http://medienorge.uib.no/?cat=lenker&amp;page=internasjonale" title="Allmenn mediestatistikk">- Internasjonale pekere</a></li>
		</ul>

<h3 class="menuheader expandable">Internett - telepriser - hastighet</h3>
<ul class="categoryitems">
		<li><a href="http://speedtest.net/" title="SPEEDTEST.NET">SPEEDTEST.NET</a></li>	
		<li><a href="http://www.telepriser.no/" title="Post- og teletilsynet (PT) Din veiviser til telepriser i Norge">Veiviser - telepriser</a></li>	
		<li><a href="http://www.bredbandskollen.se/" title="Bredbandskollen TPTEST">Bredbandskollen TPTEST</a></li>		
		<li><a href="http://www.nettfart.no/" title="Nettfart.no - Får du den bredbåndskapasiteten du forventer? ">Nettfart.no - Får du den bredbåndskapasiteten du forventer?</a></li>		
		<li><a href="http://www.tptest.se/" title="Bandbreddstestet TPTEST">Bandbreddstestet (TPTEST)</a></li>
		<li><a href="https://www.testadatorn.se/" title="Sikkerhetstest av PC">Sikkerhetstest av PC</a></li>
		<li><a href="http://security.symantec.com/sscv6/default.asp?productid=symhome&amp;langid=ie&amp;venid=sym" title="Symantec Security Check">Symantec Security Check</a></li>
		<li><a href="http://onecare.live.com/site/en-US/default.htm" title="Windows Live OneCare">Windows Live OneCare (- Få en gratis PC Sikkerhetsskanner)</a></li>
		</ul>

<h3 class="menuheader expandable">Internett - sikkerhet</h3>
<ul class="categoryitems">
		<li><a href="http://www.pegi.info/pegi/index.do" title="PEGI (Pan European Game Information)">PEGI</a></li>								
		<li><a href="http://www.barnevakten.no/" title="BarneVakten">BarneVakten</a></li>				
		<li><a href="http://www.spillforeningen.no/" title="Spillforeningen">Spillforeningen</a></li>
		<li><a href="http://www.nettvett.no/" title="Nettvettregler">Nettvettregler</a></li>
		<li><a href="http://www.google.com/intl/en/landing/familysafety/" title="Family Safety Guide (Google)">Family Safety Guide (Google)</a></li>
		<li><a href="http://www.siteadvisor.com/" title="We test the Web (McAfee - SiteAdvisor">We test the Web (McAfee - SiteAdvisor)</a></li>
		<li><a href="http://www.reddbarna.no/images/wallpaper/800x600-Alle_juger_paa_nettet.jpg" title="Redd Barna Chatteregler">Chatteregler - barn</a></li>				
		<li><a href="http://www.reddbarna.no/default.asp?V_ITEM_ID=4435" title="Redd Barna Nettvettregler">Nettvettregler - barn</a></li>
		<li><a href="http://www.saftonline.no/presse/724/" title="Kildekritikk barn">Kildekritikk - barn</a></li>
		<li><a href="http://www.saftonline.no/Kildekritikk/" title="Kildekritikk p&aring; nettet">Kildekritikk p&aring; nettet</a></li>
		<li><a href="http://nrk.no/redskap/utskriftsvennlig/5322557.html" title="Nettbrukere lar seg lure ">Nettbrukere lar seg lure</a></li>
		<li><a href="http://www.norsis.no/details.php?type=omsis" title="Norsk Senter for InformasjonsSikring (NorSIS)">Norsk Senter for InformasjonsSikring (NorSIS)</a></li>
		<li><a href="http://www.jusstorget.no/article.asp?Key=1&amp;FagKey=39&amp;ArtKey=104" title="Domenenavn p&aring; internett regeloversikt">Domenenavn - regeloversikt</a></li>		
		<li><a href="http://www.jusstorget.no/article.asp?Key=1&amp;FagKey=39&amp;ArtKey=347" title="Redakt&oslash;ransvaret p&aring; Internett">Redakt&oslash;ransvar - internett</a></li>
		<li><a href="http://www.datatilsynet.no/" title="Datatilsynet personvern">Datatilsynet - personvern</a></li>
		<li><a href="http://www.sikkerhetsportalen.no/" title="Sikkerhetsportalen">Sikkerhetsportalen</a></li>
		<li><a href="http://www.forbrukerombudet.no/?id=6&amp;subid=0" title="R&aring;d hos Forbrukerombudet">R&aring;d hos Forbrukerombudet</a></li>
		<li><a href="http://www.npt.no/" title="Post- og teletilsynet PT">Post- og teletilsynet (PT)</a></li>						
		<li><a href="http://www.nr.no/pages/common/frontpage_no" title="Norsk Regnesentral (NR)">Norsk Regnesentral (NR)</a></li>
		</ul>

<h3 class="menuheader expandable">Klager</h3>
<ul class="categoryitems">
		<li><a href="http://www.markedsradet.no/category.asp?parent_id=2" title="Markedsr&aring;det">Markedsr&aring;det</a></li>				
		<li><a href="http://www.forbrukerradet.no/" title="Forbrukerr&aring;det">Forbrukerr&aring;det</a></li>
		<li><a href="http://forbrukerportalen.no/klikkogklag" title="Forbrukerr&aring;det (KLIKK &amp; KLAG)">KLIKK &amp; KLAG</a></li>
		</ul>

<h3 class="menuheader expandable">Finne, fylle ut og levere skjemaer til offentlige etater</h3>
<ul class="categoryitems">
		<li><a href="https://www.altinn.no/" title="Altinn">Altinn</a></li>
		<li><a href="http://www.norge.no/offskjema/" title="Diverse offentlige skjemaer">Diverse offentlige skjemaer</a></li>
		<li><a href="http://app.norge.no/styresmakter/liste.asp?n=1&amp;nt=0&amp;nw=1&amp;nw1f=5&amp;nw1v=66&amp;nw1o=8&amp;nw1t=1&amp;nw1l=1&amp;nwc=20&amp;nh=1&amp;nh1s=Stat+og+kommune&amp;nc=61&amp;np=3&amp;ni=1&amp;nside=kommune" title="Kommunale skjemaer">Kommunale skjemaer</a></li>
		</ul>

<h3 class="menuheader expandable">RSS</h3>
<ul class="categoryitems">
		<li><a href="http://www.djh.dk/ejour/arkiv/RSS.html" title="RSS-feeds (eJours)">RSS-feeds (eJours)</a></li>
		</ul>

<h3 class="menuheader expandable">Podcast</h3>
<ul class="categoryitems">
		<li><a href="http://podcast.no/" title="podcast.no">podcast.no</a></li>
		<li><a href="http://podcast.com/" title="podcast.com">podcast.com</a></li>
		<li><a href="http://www.nrk.no/podcast/" title="NRK podkast">NRK podkast</a></li>	
		<li><a href="http://encyclopodia.sourceforge.net/en/index.html" title="Wikipedia - iPod">Wikipedia - iPod</a></li>				
		<li><a href="http://www.nytimes.com/ref/multimedia/podcasts.html#introduction" title="The New York Times">The New York Times</a></li>
		</ul>

<h3 class="menuheader expandable">Webcast</h3>
<ul class="categoryitems">
		<li><a href="http://www.webcast.com/" title="WEBCAST.COM (CNET Networks)">WEBCAST.COM (CNET Networks)</a></li>				
		<li><a href="http://www.webcast.no/" title="WebCast.no (WebCast Norge)">WebCast.no (WebCast Norge)</a></li>				
		<li><a href="http://www.accessdata.fda.gov/psn/viewbroadcasts.cfm" title="FDA (Food and Drug Administration)">FDA (Food and Drug Administration)</a></li>
		</ul>

<h3 class="menuheader expandable">Nedlastbar TV</h3>
<ul class="categoryitems">
		<li><a href="http://www.nrk.no/aktivum/">NRK Aktivum</a></li>
		</ul>

<h3 class="menuheader expandable">Opplysning</h3>
<ul class="categoryitems">
		<li><a href="http://www.gulesider.no/tk/" title="Gule Sider">Gule Sider</a></li>
		<li><a href="http://www.timeanddate.com/norsk/verdensur.html" title="Verdensur">Verdensur</a></li>
		<li><a href="http://www.kvasir.no/alle/" title="Alle tjenester">Alle tjenester</a></li>	
		<li><a href="http://www.opplysning1890.no/om/" title="Opplysning 1890">Opplysning 1890</a></li>
		<li><a href="http://www.opplysningen.no/BransjeSok.aspx" title="Opplysningen 1881">Opplysningen 1881</a></li>
		<li><a href="http://www.vegvesen.no/servlet/Satellite?cid=1179813233691&amp;pagename=vegvesen%2FSVVartikkel%2FSVVartikkelMedRelatert&amp;c=SVVartikkel" title="Send REGNR til 2282 (Statens vegvesen)">Sjekk hvem eier bilen - Send REGNR til 2282 (Statens vegvesen)</a></li>
		<li><a href="http://w2.brreg.no/motorvogn/index.jsp" title="Sjekk heftelser bruktbiler (Brønnøysundregistrene)">Sjekk heftelser bruktbiler (Brønnøysundregistrene)</a></li>
		<li><a href="http://www.ssb.no/navn/" title="Hvor mange heter SSB">Hvor mange heter ...?</a></li>
		<li><a href="http://www.nav.no/" title="NAV (Arbeids- og velferdsdirektoratet) (Arbeids- og velferdsetaten (tidligere Aetat og trygdeetaten)">NAV (Arbeids- og velferdsdirektoratet) (Arbeids- og velferdsetaten (tidligere Aetat og trygdeetaten))</a></li>
		<li><a href="http://epab.posten.no/" title="Postadresser N/S/DK">Postadresser N/S/DK</a></li>		
		<li><a href="http://www.ks.no/templates/Page.aspx?id=48616" title="Skoleruta (skolestart, ferier... - fylkesvis)">Skoleruta (skolestart, ferier... - fylkesvis)</a></li>
		<li><a href="http://www.proff.no/proff/index.c" title="Proff">Proff (privat og bedrift)</a></li>
		<li><a href="http://www.regelhjelp.no/" title="Regelhjelp.no">Regelhjelp.no</a></li>	
		<li><a href="http://www.skatteetaten.no/Alt-om/Om-Skatteetaten/" title="Skatteetaten">Skatteetaten</a></li>
		<li><a href="http://www.facebook.com/skattenmin" title="Skatteetaten">Skatten min (Skatteetaten på Facebook)</a></li>
		<li><a href="http://www.ij.no/kilde-og-metode.aspx" title="Kilde og metode (Institutt for Journalistikk)">Kilde og metode (Institutt for Journalistikk)</a></li>						
		<li><a href="http://w2.brreg.no/enhet/sok/" title="Enhetsregisteret">Enhetsregisteret</a></li>
		<li><a href="http://www.brreg.no/" title="Br&oslash;nn&oslash;ysundregistrene">Br&oslash;nn&oslash;ysundregistrene</a></li>
		<li><a href="https://www.altinn.no/" title="Altinn">Altinn</a></li>
		<li><a href="http://www.norge.no/" title="Diverse offentlige skjemaer">Diverse offentlige skjemaer</a></li>
		<li><a href="http://www.oep.no/" title="Offentlig elektronisk postjournal (OEP)">Offentlig elektronisk postjournal (OEP)</a></li>
		<li><a href="http://www.innsyn.no/" title="Innsyn.no">Innsyn.no</a></li>
		<li><a href="http://www.filmweb.no/" title="Filmweb">Filmweb</a></li>
		<li><a href="http://imdb.com/chart/top" title="Top 250 movies...">Top 250 movies...</a></li>
		<li><a href="http://www.metacritic.com/film/highscores.shtml" title="CNET Networks - All Time HighScores">CNET Networks - All Time HighScores</a></li>
		<li><a href="http://www.imdb.com/" title="The Internet Movie Database">The Internet Movie Database</a></li>
		<li><a href="http://www.trafikanten.no/" title="Trafikanten">Trafikanten</a></li>
		<li><a href="http://www.landsider.no/" title="UDs nye landsider">UDs nye landsider</a></li>
		</ul>

<h3 class="menuheader expandable">Oppslagsverk</h3>
<ul class="categoryitems">
		<li><a href="http://www.ordnett.no/" title="Ordnett.no">Ordnett.no (Kunnskapsforlaget)</a></li>
		<li><a href="http://www.ordbogen.com/" title="Ordbogen.com">online ordbog (Ordbogen.com)</a></li>
		<li><a href="http://www.snl.no/" title="Store norske leksikon">Store norske leksikon (Aschehoug &amp; Gyldendal) (Gratis)</a></li>
		<li><a href="http://www.denstoredanske.dk/" title="DEN STORE DANSKE (Gyldendal Encyklopædien) (Gratis)">DEN STORE DANSKE (Gyldendal Encyklopædien) (Gratis)</a></li>
		<li><a href="http://www.retriever-info.com/no/" title="ATEKST">Mediearkivet (ATEKST) (Retriever) (NTB og svenske TT)</a></li>
		<li><a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=pubmed" title="PubMed (NCBI) (SØK I MEDISINSKE ARTIKLER OG STUDIER)">PubMed (NCBI) (SØK I MEDISINSKE ARTIKLER OG STUDIER)</a></li>
		<li><a href="http://www.merriam-webster.com/" title="MERRIAM WEBSTER'S ONLINE (Engelsk ordbok) (m/uttale)">MERRIAM WEBSTER'S ONLINE (Engelsk ordbok) (m/uttale)</a></li>
		<li><a href="http://www.nlm.nih.gov/medlineplus/mplusdictionary.html" title="merriamcomdictionary" WEBSTER'S Medical Dictionary (Medisinsk ordbok - MedlinePlus)">MERRIAM WEBSTER'S Medical Dictionary (Medisinsk ordbok - MedlinePlus)</a></li>
an attribute value literal can occur in an attribute specification list only after a VI delimiter
Line: 4050, Col: 109
…" title="merriamcomdictionary" WEBSTER'S Medical Dictionary (Medisinsk ordbok …
		<li><a href="http://www.medilexicon.com/" title="Medilexicon (Medical Dictionary, Medical Terminology)">Medilexicon (Medical Dictionary, Medical Terminology)</a></li>
		<li><a href="http://nhi.no/" title="NHI.no -søk i publikumsutgaven av Legehåndboka (NEL)">NHI.no - søk i publikumsutgaven av Legehåndboka (NEL)</a></li>
		<li><a href="http://www.samlaget.no/nn-no/utdanning/ordboeker/boeker/andre-ordboeker/norsk-medisinsk-ordbok-9-utgaava.aspx" title="Norsk medisinsk ordbok">Norsk medisinsk ordbok - elektronisk utgave (Samlaget)</a></li>
		</ul>

<h3 class="menuheader expandable">Egne oversettelser</h3>
<ul class="categoryitems">
		<li><a href="http://www.mintankesmie.no/medisinske_ord_og_uttrykk_symptomer_forklaringer_og_oversettelser.php" title="Diverse medisinske ord og uttrykk">Oversettelser av medisinske ord og uttrykk (eksempel)</a></li>
		</ul>

<h3 class="menuheader expandable">Profesjonelle - autoriserte oversettelser</h3>
<ul class="categoryitems">
		<li><a href="http://www.nffo.no/oversetter1.htm" title="Finn en oversetter">Finn en oversetter</a></li>
		<li><a href="http://www.nffo.no/index.asp" title="Norsk faglitter&aelig;r forfatter- og oversetterforening (NFF)">Norsk faglitter&aelig;r forfatter- og oversetterforening (NFF)</a></li>				
		<li><a href="http://www.oversetterforeningen.no/" title="Norsk Oversetterforening (NO)">Norsk Oversetterforening (NO)</a></li>
		<li><a href="http://www.statsaut-translator.no/website.aspx?displayid=25" title="Statsautoriserte Translat&oslash;rers Forening STF">Statsautoriserte Translat&oslash;rers Forening (STF)</a></li>
		</ul>

<h3 class="menuheader expandable">Diverse ressurser</h3>
<ul class="categoryitems">
		<li><a href="http://detektor.deichman.no/" title="Ressurser">Detektor</a></li>
		<li><a href="http://www.elevsonen.no/default.asp?page_id=15" title="Elevsonen">Elevsonen</a></li>				
		<li><a href="http://www.hardefakta.no/" title="hardefakta.no">hardefakta.no</a></li>
		<li><a href="http://statbank.ssb.no/statistikkbanken/" title="Statistikkbanken">SSB: Statistikkbanken (lagre for senere bruk)</a></li>
		<li><a href="http://www.ssb.no/emner/" title="Statistikker ordnet etter emne">Statistikker - emne</a></li>
		<li><a href="http://www.ssb.no/veiviser/" title="Veiviseren fra A til Å">Veiviseren fra A til Å</a></li>													
		<li><a href="http://www.nsd.uib.no/" title="Norsk samfunnsvitenskapelig datatjeneste (NSD)">Norsk samfunns-vitenskapelig data-tjeneste (NSD)</a></li>				
		<li><a href="http://www.nla.no/index.php?ID=993" title="Oppslagsverk p&aring; nettet">Oppslagsverk p&aring; nettet</a></li>
		<li><a href="http://www.Pengeforlaget.no/" title="Pengeforlaget ">Pengeforlaget </a></li>
		<li><a href="http://digitaldutch.com/unitconverter/" title="WWW unit converter">WWW unit converter</a></li>
		<li><a href="http://forbruker.no/kalkulatorer/" title="Kalkulatorer">Kalkulatorer - forbruk</a></li>	
		<li><a href="http://www.norskfamilie.no/wsp/nofa/frontend.cgi?session=260662e7a60126144dc60a6b852d9a&amp;func=publish.show&amp;func_id=12&amp;table=PUBLISH&amp;item=" title="Norsk Familieøkonomi (kalkulatorer/barometere)">Norsk Familieøkonomi (kalkulatorer/barometere)</a></li>
		</ul>

<h3 class="menuheader expandable">Reklame</h3>
<ul class="categoryitems">
		<li><a href="http://imarkedet.no/php/art.php?id=282603" title="Venter mer annonsering i 2006">Venter mer annonsering i 2006</a></li>				
		<li><a href="http://www.zenithoptimedia.com/gff/index.cfm?id=60" title="Advertising Expenditure Forecasts (December 2005)">Advertising Expenditure Forecasts (December 2005)</a></li>
		</ul>

<h3 class="menuheader expandable">Konjunkturer</h3>
<ul class="categoryitems">
		<li><a href="http://www.norges-bank.no/" title="Norges Bank">Norges Bank</a></li>
		<li><a href="http://www.norges-bank.no/Pages/Article____200.aspx" title="Valutakurser">Valutakurser</a></li>
		<li><a href="http://www.economist.com/finance/displaystory.cfm?story_id=6972477" title="Big Mac index">Big Mac index</a></li>
		<li><a href="http://www.samfunnsbarometer.no/d/informasjon.shtml" title="Norsk Samfunnsbarometer">Norsk Samfunnsbarometer</a></li>
		<li><a href="http://www.oslobors.no/ob/oslobors" title="Oslo B&oslash;rs Holding ASA">Oslo B&oslash;rs Holding ASA</a></li>			
		<li><a href="http://www.ssb.no/kbar/" title="SSB: Konjunkturbarometeret">SSB: Konjunkturbarometeret</a></li>
		</ul>

<h3 class="menuheader expandable">Største firmaer</h3>
<ul class="categoryitems">
		<li><a href="http://money.cnn.com/magazines/fortune/fortune500/2010/full_list/index.html" title="FORTUNE 500O (America's largest corporations)">FORTUNE 500O (2005 - 2010) (America's largest corporations)</a></li>
		<li><a href="http://www.forbes.com/lists/2009/18/global-09_The-Global-2000_Rank.html" title="Forbes Global 2000 list of the world's biggest companies">Forbes Global 2000 list of the world's biggest companies</a></li>
		</ul>

<h3 class="menuheader expandable">Mest verdifulle (innovative) merkevarer</h3>
<ul class="categoryitems">
		<li><a href="http://www.businessweek.com/interactive_reports/innovative_50_2009.html?chan=magazine+channel_in%253A+inside+innovation" title="Interactive Table: The 50 Most Innovative Companies">Interactive Table: The 50 Most Innovative Companies</a></li>
		<li><a href="http://www.businessweek.com/interactive_reports/top_brands.html" title="Interactive Table: Top 100 Global Brands Scoreboard">Interactive Table: Top 100 Global Brands Scoreboard</a></li>
		</ul>

<h3 class="menuheader expandable">Verdens beste flyselskaper</h3>
<ul class="categoryitems">
		<li><a href="http://www.forbes.com/home/lifestyle/2007/08/09/travel-airlines-firstclass-forbeslife-cx_sv_airlinesland.html" title="World's Best Airlines">World's Best Airlines</a></li>				
		<li><a href="http://www.forbes.com/2007/08/09/travel-carriers-affordable-forbeslife-cx_lk_0809biztravel.html" title="Verdens beste billig-flyselskaper">Verdens beste billig-flyselskaper</a></li>
		</ul>

<h3 class="menuheader expandable">Verste firmaer</h3>
<ul class="categoryitems">
		<li><a href="http://www.google.no/search?hl=no&amp;q=Worst+Corporations&amp;btnG=S%C3%B8k&amp;meta=" title="The 10 Worst Corporations">The 10 Worst Corporations</a></li>
		</ul>

<h3 class="menuheader expandable">Rikeste - viktigste mennesker</h3>
<ul class="categoryitems">
		<li><a href="http://www.forbes.com/lists/" title="Forbes annual rankings lists">Forbes annual rankings</a></li>	
		<li><a href="http://www.forbes.com/400richest/" title="Forbes 400">Forbes 400</a></li>		
		<li><a href="http://www.forbes.com/2009/11/04/china-400-richest-china-billionaires-09-wealth_land.html?partner=globalnews_newsletter" title="China's 400">China's 400</a></li>		
		<li><a href="http://www.forbes.com/2009/03/11/worlds-richest-people-billionaires-2009-billionaires_land.html" title="Forbes One Billion">Forbes One Billion</a></li>			
		<li><a href="http://www.hegnar.no/andre_tjenester/rikeste400/" title="Kapital 400">Kapitals 400</a></li>	
		<li><a href="http://www.forbes.com/lists/2006/10/Rank_1.html" title="Forbes Global">Forbes Global 700</a></li>
		<li><a href="http://money.cnn.com/magazines/business2/peoplewhomatter/" title="Business 2.0 - 50 who matter now">Business 2.0 - 50 who matter now</a></li>
		<li><a href="http://www.time.com/time/specials/2007/completelist/0,,1733748,00.html" title="The 2008 TIME 100 - The World's Most Influential People">The 2008 TIME 100 - The World's Most Influential People</a></li>	
		<li><a href="http://www.forbes.com/2008/08/27/most-powerful-women-biz-powerwomen08-cz_me_cs_0827women_land.html?partner=daily_newsletter" title="Forbes: The World's Most Powerful Women">Forbes: The World's Most Powerful Women</a></li>
		<li><a href="http://www.forbes.com/2009/11/11/worlds-most-powerful-leadership-power-09-people_land.html" title="The World's Most Powerful People">The World's Most Powerful People</a></li>
		<li><a href="http://www.theonion.com/content/node/52828" title="America's 50 Poorest People (Onion - Weekender)">America's 50 Poorest People (Onion - Weekender)</a></li>
		</ul>

<h3 class="menuheader expandable">Journalistikk</h3>
<ul class="categoryitems">
		<li><a href="http://www.ram.no/" title="R&aring;det for anvendt medieforskning (RAM)">R&aring;det for anvendt medieforskning (RAM)</a></li>
		<li><a href="http://www.pressefag.no/PK/pekere.html" title="PresseFAG">PresseFAG</a></li>
		<li><a href="http://www.fagpressen.no/" title="Fagpressen">Fagpressen</a></li>
		<li><a href="http://www.bi.no/templates/artikkel____31880.aspx" title="Medieverden">Medieverden</a></li>				
		<li><a href="http://www.ij.no/" title="Institutt for Journalistikk">Institutt for Journalistikk</a></li>
		<li><a href="http://www.bokogsamfunn.no/" title="Bok og samfunn">Bok og samfunn</a></li>				
		<li><a href="http://www.mediebedriftene.no/" title="Mediebedriftenes Landsforening MBL">Mediebedriftenes Landsforening</a></li>
		<li><a href="http://www.presse.no/" title="Norsk Presseforbund PFU">Norsk Presseforbund (PFU)</a></li>
		<li><a href="http://www.pressehistorisk.no/" title="Norsk Pressehistorisk Forening">Norsk Pressehistorisk Forening</a></li>				
		<li><a href="http://www.dagensmedier.no/index.asp" title="DAGENSMEDIER">DagensMedier</a></li>
		<li><a href="http://www.mio.no/" title="Mediebyr&aring;enes Interesseorganisasjon MIO">Mediebyr&aring;enes Interesse-organisasjon (MIO)</a></li>
		<li><a href="http://medienorge.uib.no/vis2.cfm?side=NORPEKERE#1" title="Massemedier - lenker">Massemedier - lenker</a></li>				
		<li><a href="http://www.ij.no/doksenteret/offdok/" title="Institutt for Journalistikk Offentlig informasjon p&aring; Internett">Offentlig informasjon p&aring; Internett</a></li>
		<li><a href="http://www.fair.org/index.php?page=7&amp;issue_area_id=57" title="Fairness &amp; Accuracy in Reporting FAIR">FAIR</a></li>
		<li><a href="http://www.mediesnakk.no/" title="Mediesnakk.no">Mediesnakk.no</a></li>
		<li><a href="http://www.nrk.no/mediekritikk/2121480.html" title="Mediekritikk.no">Mediekritikk.no</a></li>
		<li><a href="http://www.journalism.co.uk" title="FJournalism.co.uk">Journalism.co.uk</a></li>
		</ul>

<h3 class="menuheader expandable">Juss (lover, lovdata, rettssikkerhet)</h3>
<ul class="categoryitems">
		<li><a href="http://www.mintankesmie.no/lover_lovdata_og_rettssikkerhet.php" title="lovdata.no">lovdata.no</a></li>
		<li><a href="http://www.mintankesmie.no/advokater.php" title="Advokater/">Advokater</a></li>
		<li><a href="http://www.jussportalen.no/" title="Jussportalen/">Jussportalen</a></li>									
		<li><a href="http://www.mintankesmie.no/dommere_og_domstoler.php" title="Dommere og domstoler">Dommere og domstoler</a></li>		
		<li><a href="http://www.mintankesmie.no/forliksradene_forliksklager_innkassoklagenemnda_post_og_teletilsynet.php" title="Forliksr&aring;det - forliksklage">Forliksr&aring;det - forliksklage</a></li>			
		<li><a href="http://www.mintankesmie.no/konfliktradet.php" title="Konfliktr&aring;det">Konfliktr&aring;det</a></li>
		<li><a href="http://www.mintankesmie.no/riksadvokaten.php" title="Riksadvokaten - Statsadvokatene (Den høyere påtalemyndighet)">Riksadvokaten - Statsadvokatene (Den høyere påtalemyndighet)</a></li>
		<li><a href="http://www.mintankesmie.no/regjeringsadvokaten.php" title="Regjeringsadvokaten (statens advokatkontor i sivile saker)">Regjeringsadvokaten (statens advokatkontor i sivile saker)</a></li>					
		<li><a href="http://www.domstol.no/no/Juridisk-ordliste/" title="Juridisk ordliste (Domstol.no)">Juridisk ordliste (Domstol.no)</a></li>
		<li><a href="http://www.ub.uib.no/avdeling/jur/arkiv/forelesn.htm" title="Lov og rett p&aring; nett">Lov og rett p&aring; nett</a></li>
		<li><a href="http://www.sismo.no/dinsak.jsp" title="Statens innkrevingssentral SI ">Statens innkrevingssentral</a></li>
		<li><a href="http://www.ub.uio.no/ujur/prjus/litteraturen/forkortelser.html" title="Forkortelsesregister (Juss)">Forkortelsesregister (Juss)</a></li>		
		<li><a href="http://www.mintankesmie.no/politiet_etterforskning_politianmeldelser_osv.php" title="Politiet, politianmeldelser osv.">Politiet, politianmeldelser osv.</a></li>			
		<li><a href="http://www.mintankesmie.no/menneskerettigheter_menneskerettighetsdomstolen.php" title="Menneskerettigheter (Den europeiske menneskerettighetsdomstolen (EMD) i Strasbourg)">Menneskerettigheter (Den europeiske menneskerettighetsdomstolen (EMD) i Strasbourg)</a></li>
		<li><a href="http://www.advokatbladet.no/" title="Advokatbladet (eblad / PDF)"></a></li>
		<li><a href="http://web.archive.org/web/20070402042113/http://www.fagpressekatalogen.no/blader/0001.html" title="Advokatbladet (opplag)">Advokatbladet (opplag)</a></li>
		<li><a href="http://www.domstol.no/Domstoladministrasjonenno/Almmuhusat/Rett-pa-sak/" title="Domstolmagasinet Rett på sak">Domstolmagasinet Rett på sak</a></li>
		<li><a href="http://www.mintankesmie.no/biblioteker_abm.php" title="Norsk Retstidende">Norsk Retstidende</a></li>		
		<li><a href="http://www.idunn.no/ts/tfr" title="Tidsskrift for Rettsvitenskap">Tidsskrift for Rettsvitenskap</a></li>				
		</ul>

<h3 class="menuheader expandable">Spill</h3>
<ul class="categoryitems">
		<li><a href="http://www.norsk-tipping.no/" title="Norsk Tipping">Norsk Tipping</a></li>
		<li><a href="http://www.norsk-tipping.no/page?id=97&amp;tp=tm" title="Norsk Tipping: Min side">Min side</a></li>
		<li><a href="http://www.norsk-tipping.no/page?id=224" title="PC-spill">PC-spill</a></li>
		<li><a href="http://www.norsk-tipping.no/page?id=40&amp;tp=rbnr3&amp;WT.ac=blinettspilltopph" title="Begynn å spille på internett!">Begynn å spille på internett!</a></li>
		<li><a href="http://www.norsk-tipping.no/page?id=93&amp;key=24303&amp;tp=cfe" title="Spill på mobilen din">Spill på mobilen din</a></li>
		<li><a href="http://www.tips.as/" title="Tips.as">Tips.as</a></li>
		<li><a href="http://www.fotballen.eu/" title="Fotballen.eu">Fotballen.eu</a></li>
		<li><a href="http://www.fotball.no/t2.aspx?p=53184&amp;cat=51834" title="Norges Fotballforbund (NFF) - Resultater, tabeller...">Norges Fotballforbund (NFF) - Resultater, tabeller...</a></li>
		<li><a href="http://www.livescore.com/" title="livescore.com">livescore.com</a></li>			
		<li><a href="http://news.bbc.co.uk/sport1/hi/football/default.stm" title="BBC SPORT FOOTBALL">BBC SPORT FOOTBALL (resultater, tabeller, BBC Radio Five Live etc.)</a></li>
		<li><a href="http://www.rikstoto.no/" title="Norsk Rikstoto">Norsk Rikstoto</a></li>			
		<li><a href="https://www.rikstoto.no/NyRegistrering/Default.aspx=&quot;Bli nettspiller hos Norsk Rikstoto&quot;">Bli nettspiller hos Norsk Rikstoto</a></li>
		<li><a href="https://www.rikstoto.no/DinSide/Default.asp?SSL=1" title="Norsk Rikstoto: Din side">Norsk Rikstoto: Din side</a></li>			
		<li><a href="http://www.nrk.no/sport/sport_og_spill/hestesport/resultater/" title="Markerings- og resultatoversikt">Markerings- og resultatoversikt V5-65-75</a></li>
		<li><a href="http://www.nettavisen.no/sport/trav/" title="Travmagasinet - Nettavisen.no">Travmagasinet - Nettavisen.no</a></li>
		</ul>

<h3 class="menuheader expandable">Programoversikt for radio og TV</h3>
<ul class="categoryitems">
		<li><a href="http://www.nrk.no/programoversikt/p.sg?id=4471&amp;id=&amp;fvis=&amp;aktiv=1&amp;p_format=HTML&amp;p_type=prog&amp;p_periode=neste7dager&amp;p_p1=P1&amp;p_knapp=Vis%20nedenfor/" title="NRK">NRK</a></li>
		<li><a href="http://pub.tv2.no/nettavisen/tv/" title="TV 2 osv.">TV 2 osv.</a></li>
		<li><a href="http://tv.aftenposten.no/" title="P&aring; TV akkurat n&aring; TV 2">P&aring; TV akkurat n&aring;</a></li>
		<li><a href="http://fredag.dagbladet.no/tv/" title="Alle kategorier">Alle kategorier</a></li>
		<li><a href="http://www.se.no/tv/" title="Se.no">Se.no</a></li>
		<li><a href="http://interaktiv.vg.no/tv/index.php?now=1&amp;max=3&amp;sortby=tid&amp;kanal[]=202&amp;kanal[]=229&amp;kanal[]=230&amp;kanal[]=11&amp;kanal[]=13&amp;kanal[]=865&amp;kanal[]=1032&amp;kankat=Norske+kanaler" title="Akkurat n&aring; og 3 timer frem">Akkurat n&aring; og 3 timer frem</a></li>			
		<li><a href="http://www.radiotimes.com/tv/now.html/" title="Radio Times - The best thing on TV, Film and Radio. ... ">Radio Times - The best thing on TV, Film and Radio. ... </a></li>
		</ul>

</div>
</div></div>
				    </div>
				 </div>
				 <div class="columns">
				    <div class="columnlarge">
					  <h3>- Dekonstruksjon. (- Den omhyggelige uttrevlinga av motstridende betydningskrefter i teksten.) (- De som kritiserer oss, aner stort sett ikke hva de snakker om. Oss har de i alle fall ikke lest, langt mindre forstått.) (- Som et definisjonsforsøk kan vi altså si at dekonstruksjon er en analytisk operasjon som tar sikte på å blottlegge, vise fram, trevle fra hverandre, de motsigelsene som konstituerer teksten og som teksten forsøker å skjule, sier Atle Kittang.)</h3>
	    <p><a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770519.html">Dekonstruksjon<br />
	      1. Et nytt ord p&aring; fransk</a> (<a href="http://web.archive.org/web/20030326101146/http://www.nrk.no/litteratur/lesekunst/teorier/1770519.html">archive.org</a>) <br />
NRK 16.4.2002<strong></strong><br />
&ndash; Ordet dekonstruksjon er ikke et ord de fleste umiddelbart vil ha assosiasjoner til. Hva betyr det?</p>
	    <p>&ndash; Ordet dekonstruksjon er et nytt ord, et begrep som f&oslash;rst og fremst knyttes til den franske filosofen Jacques Derrida.</p>
	    <p><strong>Forekomst i ordb&oslash;ker</strong><br />
  I den siste utgaven av den store franske ordboken &rdquo;Petit Robert&rdquo; er b&aring;de substantivet &rdquo;d&eacute;construction&rdquo; og verbet &rdquo;d&eacute;construire&rdquo; tatt inn. Ordet &rdquo;d&eacute;construction&rdquo; skal ha hatt sin f&oslash;rste tilsynekomst i fransk spr&aring;k i 1965, mens verbet &quot;d&eacute;construire&quot; er belagt til 1970. S&aring; nytt er det. </p>
          <p>Ordet er laget av det velkjente ordet konstruere, som betyr &aring; reise eller bygge opp. N&aring;r franskmennene setter et d&eacute;- foran, s&aring; handler det om &aring; reversere denne bevegelsen, alts&aring; det &aring; bygge ned.</p>
          <p>Ordet er laget av det velkjente ordet konstruere, som betyr &aring; reise eller bygge opp. N&aring;r franskmennene setter et d&eacute;- foran, s&aring; handler det om &aring; reversere denne bevegelsen, alts&aring; det &aring; bygge ned.</p>
          <p><strong>Ikke &oslash;delegge, men analysere</strong><br />
&ndash; Er det en motsetning til &aring; bygge? </p>
          <p>&ndash; Det er en motsetning til &aring; konstruere. Men det er ikke den typen motsetning som en har for eksempel i &aring; &oslash;delegge, &aring; destruere. Det er forskjell mellom destruksjon og dekonstruksjon. Det har ordets opphavsmann, Jacques Derrida, understreket meget sterkt. (...)</p>
          <p><strong>Definisjon av ordet</strong><br />
&ndash; Hva er spesielt med dekonstruksjonens analysem&aring;te? </p>
          <p>&ndash; Det finnes en del definisjoner av dekonstruksjonsbegrepet. Den aller enkleste jeg har funnet er fra en av de amerikanske dekonstruksjonistene, Barbara Johnson. Hun definerer dekonstruksjon som &rdquo;<em>den omhyggelige uttrevlinga av motstridende betydningskrefter i teksten</em>&rdquo;. (...)</p>
          <p>Som et definisjonsforsøk kan vi altså si at dekonstruksjon er en analytisk operasjon som tar sikte på å blottlegge, vise fram, trevle fra hverandre, de motsigelsene som konstituerer teksten og som teksten forsøker å skjule, sier Atle Kittang. (...) </p>
          <p>(<strong>Anm</strong>:  <em>Dekonstruksjon</em> (<a href="http://no.wikipedia.org/wiki/Dekonstruksjon">no.wikipedia.org</a>).)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/justismord.php">Justismord (og rettssikkerhet) (mintankesmie.no)</a>.</p>
          <p>(<strong>Anm</strong>:   For første gang er den historiske forskjellen på fattig og rik i Norge  kartlagt. Resultatet kan overraske deg. (…) <strong>Fase  4: 1980–2013 Økende forskjeller på nytt. </strong>Gjennom 1980- og 1990-årene økte  forskjellene i Norge, tallene levner ingen tvil om dét. (<a href="http://www.mintankesmie.no/fattigdom_fordelingspolitikk_og_rikdom.php#okende_forskjeller_pa_nytt">aftenposten.no  26.1.2017</a>).) </p>
<p>(<strong>Anm</strong>:  Trond  Giske, nestleder i Arbeiderpartiet. Politikk for økte forskjeller. Høyrepolitikk  gir et sikkert resultat: Større forskjeller mellom folk. (<a href="https://www.nrk.no/ytring/politikk-for-okte-forskjeller-1.13497896">nrk.no  2.5.2017</a>).) </p>
<h3>- Er leger forskere? (- I sin arbeidsmetodikk er de mer lik jazzmusikere enn forskere.)</h3>
<p>(<strong>Anm</strong>: Er leger forskere?  (...)  De fleste leger følger velkjente mønstre og regler, improviserer ofte rundt disse regler. I sin arbeidsmetodikk er de mer lik jazzmusikere enn forskere. (Doctors are not scientists)  (<a href="http://www.mintankesmie.no/er_leger_forskere.php">Editor's Choice (Redaktørens valg) BMJ 2004;328 (19 June</a>).) </p>
                      <p>(<strong>Anm</strong>: For  mange retningslinjer for behandlinger er skrevet av eksperter med finansielle  konflikter, ifølge studie. (Too many treatment guidelines are written by experts with financial conflicts, study finds). (<a href="http://www.mintankesmie.no/retningslinjer_og_veiledere.php#eksperter_med_okonomiske_konflikter">statnews.com 22.8.2016</a>).) </p>
<p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/legemiddelkonsulenter.php#opplyser_ikke">Legemiddelkonsulenter  forteller leger lite om sideeffekter, ifølge studie. (Drug Reps Tell Docs  Little of Side Effects: Survey) (Journal of General Internal Medicine 2013  (April)</a>.)</p>
<h3>- Solberg: -  Ikke bekymret for Facebooks makt. (- Jeg liker rap-musikk, jeg spiller  dataspill, men dere vil bare selge meg ting dere mener damer over 50 skal ha,  sa hun til latter fra salen.) (- Det skaper en plattform som gjør det lettere å  selge noen produkter, men det er en utfordring for andre, sier hun til.)</h3>
<p>(<strong>Anm</strong>: - Solberg: - Ikke bekymret for  Facebooks makt. (…) - Jeg liker rap-musikk, jeg spiller dataspill, men dere vil  bare selge meg ting dere mener damer over 50 skal ha, sa hun til latter fra  salen. (…) - Kan Facebook og Google bli så mektige at de blir en trussel for  medienes eksistensgrunnlag og på den måten en trussel for demokratiet? - Det er  ingen tvil om at det er en utfordring på annonsemarkedet, men samtidig kan det  skape andre arbeidsplasser. Det skaper en plattform som gjør det lettere å  selge noen produkter, men det er en utfordring for andre, sier hun til. (…) Statsministeren  var ikke den eneste profilen som kastet glans over åpningen av Facebook Norge.  Det gjorde også alpinist Aksel Lund Svindal. (<a href="http://www.mintankesmie.no/reklame_sponsing_journalistikk_spin_og_pr_virksomhet.php#ikke_bekymret_for_facebooks_makt">kampanje.no  31.5.2016</a>).)</p>
<h3>- Har den «europeiske eliten» mistet kontakt med egen befolkning? Europa og USA står ved et veiskille hvor sterke radikale og illiberale krefter utfordrer det liberale demokratiets orden.</h3>
<p>(<strong>Anm</strong>:  BÅRD  LARSEN, historiker i tankesmien Civita. Har den «europeiske eliten» mistet  kontakt med egen befolkning? Europa og USA står ved et veiskille hvor sterke  radikale og illiberale krefter utfordrer det liberale demokratiets orden. (…) Kan  gå i oppløsning. En relativt overraskende pessimist er den liberale britiske  historikeren Timothy Garton Ash, som i et intervju med danske <a href="http://politiken.dk/debat/article5601705.ece">Politiken</a> i desember 2015  kritiserte en europeisk elite for ikke å forstå den kulturelle og sosiale  dybden i befolkningens «avsky for eliten». (<a href="http://www.vg.no/nyheter/meninger/internasjonal-politikk/har-den-europeiske-eliten-mistet-kontakt-med-egen-befolkning/a/23909091/">vg.no  27.1.2017</a>).)</p>
<p>(<strong>Anm</strong>:  Hvor er Mark Zuckerberg i  diskusjonen om egen makt? | Espen Egil Hansen. I hvert TV-studio hvor Facebooks  maktposisjon diskuteres står det en tom stol. I hver avisartikkel, i hver  bloggpost og i hver Facebook-tråd som utfordrer selskapet, mangler en deltaker.  Mark Zuckerberg er mektigere enn mange statsledere. Vi må forvente at han  deltar i denne samtalen. Jeg hadde tre mål med <a href="http://www.aftenposten.no/meninger/kommentar/Kjare-Mark-Jeg-skriver-for-a-fortelle-at-jeg-ikke-vil-etterkomme-kravet-om-a-fjerne-dette-bildet-604142b.html">mitt åpne  brev til Mark Zuckerberg</a> – &rdquo;Dear Mark&rdquo;. Foreløpig er kun to av dem  nådd. (<a href="http://www.aftenposten.no/meninger/kommentar/Hvor-er-Mark-Zuckerberg-i-diskusjonen-om-egen-makt--Espen-Egil-Hansen-604863b.html">aftenposten.no  20.9.2016</a>).)</p>
<h3>- Leder. Regjeringen kutter i fri rettshjelp. Er rettssystemet bare  for de rikeste, Erna Solberg? Dagbladet mener: Regjeringens kutt i fri  rettshjelp er med på å svekke tilliten til rettssystemet. Fri rettshjelp bør  være en grunnplanke i en liberal rettsstat.</h3>
<p>(<strong>Anm</strong>: Regjeringen  kutter i fri rettshjelp. Er rettssystemet bare for de rikeste, Erna Solberg? Dagbladet  mener: Regjeringens kutt i fri rettshjelp er med på å svekke tilliten til  rettssystemet. <strong>Fri rettshjelp bør være</strong> en grunnplanke i en liberal  rettsstat. Under denne regjeringen har ordningen vært under vedvarende press. I  hvert statsbudsjett har Erna Solbergs regjering foreslått kutt og begrensninger  i tilbudet. Det har som regel vært Venstres sure plikt å bruke politisk kapital  på å reversere kuttene. Nå sitter Venstre i regjering og dermed er det alvorlig  grunn til bekymring når regjeringen i revidert budsjett i praksis innskrenker  adgangen til fri rettshjelp for uføretrygdete og lavtlønte som lever på  fattigdomsgrensa. (<a href="https://www.dagbladet.no/kultur/er-rettssystemet-bare-for-de-rikeste-erna-solberg/69825480">dagbladet.no  22.5.2018</a>).)</p>
<p>(<strong>Anm</strong>: - Forskning viser en klar sammenheng mellom rettshjelpsbehov og fattigdomsproblemer - Ressurssvake når ikke frem i retten. (<a href="http://www.mintankesmie.no/fattigdom_fordelingspolitikk_og_rikdom.php#styrk_rettshjelp">forskning.no 27.9.2011</a>).)</p>
<h3>-  Lederartikler.  Å gjøre pasientrelevant klinisk forskning til en realitet. Forskere,  bidragsytere (sponsorer; finansiører) og utgivere har alle et arbeid å gjøre. </h3>
<p>(<strong>Anm</strong>: Lederartikler.  Å gjøre pasientrelevant klinisk forskning til en realitet. Forskere,  bidragsytere (sponsorer; finansiører) og utgivere har alle et arbeid å gjøre (Editorials.  Making patient relevant clinical research a reality. Researchers, funders, and  publishers all have work to do.) <a href="http://www.mintankesmie.no/offentlig_forvaltning.php#pasientrelevant_klinisk_forskning">BMJ  2016;355:i6627 (Published 23 December 2016)</a>.)</p>
<p>(<strong>Anm</strong>:  Den  økonomiske ulikheten øker: Selv med Ap i regjering vil de ressurssterke vinne  terreng. Arbeiderpartiet anklager Høyre for klestyveri, men blir selv avkledd i  forsøket, skriver Ola Magnussen Rydje. (<a href="http://www.dagbladet.no/kultur/selv-med-ap-i-regjering-vil-de-ressurssterke-vinne-terreng/67638723">dagbladet.no  30.5.2017</a>).)  </p>
<p>(<strong>Anm</strong>:  Folkemengde  og befolkningsendringer (<a href="http://www.ssb.no/befolkning/artikler-og-publikasjoner/den-lage-folkeveksten-held-fram">ssb.no  19.5.2017</a>).) </p>
<p>(<strong>Anm</strong>:  Feil om høyrepopulismen i  Europa | Kristin Clemet, leder i Civita. (…) I et innlegg i <a href="http://www.aftenposten.no/meninger/kommentar/Clemets-omskriving-av-historien--Marte-Gerhardsen-620033b.html">Aftenposten  28. april</a> påstår Marte Gerhardsen at jeg «forsøker å tegne et bilde  der høyrepopulismens vekst utelukkende skyldes innvandring», mens Gerhardsen  mener at årsaken er økonomisk ulikhet. (<a href="http://www.aftenposten.no/meninger/debatt/-Feil-om-hoyrepopulismen-i-Europa--Kristin-Clemet-620298b.html">aftenposten.no  3.5.2017</a>).)</p>
<p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/tankesmier.php">Tankesmier (mintankesmie.no)</a>.)</p>
<p>(<strong>Anm</strong>:  Liste over Norges  regjeringer (<a href="https://no.wikipedia.org/wiki/Liste_over_Norges_regjeringer">no.wikipedia.org</a>).)					  </p>
<p>(<strong>Anm</strong>:  Drammen på fattigdomstoppen av  storbyene. Drammen går forbi Oslo blant storbyene i Norge med størst  barnefattigdom: Her vokser nesten hvert femte barn opp i en familie med lav  inntekt. (…)<strong> Dårlig økonomi gir vanskelig oppvekst</strong>. Fra perioden 1997–1999 til  2013–2015 økte andelen norske barn som vokste opp i vedvarende lavinntekt i  Norge fra 4,1 prosent til 10 prosent. (<a href="http://www.aftenposten.no/norge/Drammen-pa-fattigdomstoppen-av-storbyene-617642b.html?spid_rel=2">aftenposten.no  29.3.2017</a>).) 					  </p>
					  <p>(<strong>Anm</strong>:  Barnefattigdom  i Norge tredoblet siden 2001. Hvert femte barn, eller om lag 18.500 av landets  98.000 barn i fattige familier, bor i Oslo, viser ny forskning. Konsentrasjonen  av barnefattigdom i visse bydeler i Oslo er betydelig både i antall og andel. Det  kommer fram i en <a href="https://www.bufdir.no/bibliotek/Dokumentside/?docId=BUF00004132">rapport</a> publisert av  Arbeidsforskningsinstituttet (AFI) for Barne-, ungdoms- og familiedirektoratet  (Bufdir). (<a href="https://www.aftenposten.no/norge/i/xqLBp/Barnefattigdom-i-Norge-tredoblet-siden-2001">aftenposten.no  13.8.2017</a>).)</p>
					  <p>(<strong>Anm</strong>:  Lysbakken  sa at 98.000 barn lever i fattigdom. Stemmer det? Vi har sjekket påstanden fra  SVs Audun Lysbakken. (…) Han er ikke den eneste. Både andre politikere,  organisasjoner og media, også <a href="https://www.nrk.no/nyheter/barnefattigdom-i-norge-1.11632636">NRK</a>,  har brukt dette tallet for å sette en størrelse på fattigdom i Norge. (…) <strong>Men er de fattige?</strong> Men er vedvarende  lavinntekt det samme som at familiene lever i fattigdom? (…) Forskerne mener at  siden skatten kommer tilbake til husholdningene i form av gratis eller  subsidierte tjenester, så bør verdien av disse tas hensyn til. (…) Forskerne er  enige om at vedvarende lavinntekt innebærer en risiko for å vokse opp i  fattigdom, men det er ikke statistisk dekning for å sette likhetstegn mellom  denne risikoen og det å faktisk være fattig. (…) <strong>Delvis feil.</strong> (<a href="https://www.nrk.no/norge/lysbakken-sa-at-98.000-barn-lever-i-fattigdom.-stemmer-det_-1.13460736">nrk.no  16.8.2017</a>).)          </p>
					  <h3><a name="lovens_makt" id="lovens_makt"></a>- Derrida, Jacques (- De som kritiserer oss, aner stort sett ikke hva de snakker om. Oss har de i alle fall ikke lest, langt mindre forstått.)</h3>
          <p><a href="http://www.libris.no/jacques-derrida--lovens-makt-autoritetens-mystiske-grunnlag--9788243002418.aspx">Lovens makt 
          autoritetens mystiske grunnlag</a> (Jacques Derridas. Force de loi. Le &rdquo;Foundement mystique de l&rsquo;autoritet&eacute;&rdquo;)<br />
          libris.no (10.12.2012)<br />          
          (...) Tittelen antyder et sp&oslash;rsm&aring;l som selv tar form av en mistanke: sikrer, tillater og autoriserer dekonstruksjonen muligheten for rettferdighet? Gj&oslash;r den rettferdighet &ndash; eller en konsekvent diskurs om rettferdighet og mulighetsbetingelsene for rettferdighet &ndash;mulig? Ja, ville noen svare, nei, svarer man i den andre leiren. Har de s&aring;kalte &rdquo;dekonstruksjonistene&rdquo; noe &aring; gj&oslash;re med rettferdighet, noe &aring; si om den? Hvorfor snakker de i grunnen s&aring; lite om den? Interesserer den dem egentlig? Er det ikke slik som noen har mistanke om, at dekonstruksjonen i seg selv ikke tillater noen rettferdig handling, ikke noen rettferdig diskurs om rettferdighet, men i stedet selv utgj&oslash;r en trussel mot retten og &oslash;delegger selve mulighetsbetingelsen for rettferdighet? Ja, ville noen svare, nei, ville motstanderne si.&rdquo; (...)</p>
          <p> <a name="i_rettens_lovens_og_rettferdighetens" id="i_rettens_lovens_og_rettferdighetens"></a>Det er dessuten normalt, forutsigelig og &oslash;nskelig at dekonstruktive studier munner ut i rettens, lovens og rettferdighetens problemfelt. (...) </p>
        <p>Mange vil kanskje forbauses over denne boka. Dreier dekonstruksjon seg om rett og rettferdighet? Er det ikke en heller obskur retning innenfor nyere litteraturfilosofi? I Norge har jo dekonstruksjonen blitt utlagt slik. Som uforst&aring;elig. Nihilistisk. Esoterisk. T&aring;keprat. Men som Derrida skriver i sin minnebok om Paul de Man: &rdquo;<em>de som kritiserer oss, aner stort sett ikke hva de snakker om. Oss har de i alle fall ikke lest, langt mindre forst&aring;tt</em>.<sup>1</sup> </p>
        <p> Dekonstruksjonen er en grein av det som kalles nyretorikken. Den springer ut av en fornyet interesse for klassisk retorikk, antikkens spr&aring;kfilosofi og kommunikasjonsteori. (...)</p>
        <p>(<strong>Anm</strong>:  <em>diskurs;</em> (av lat. 'l&oslash;pe hit og dit') samtale, vidl&oslash;ftig dr&oslash;ftelse, disputt. <strong>Kilde</strong>: <a href="http://www.snl.no/diskurs">Store norske leksikon</a>.)</p>
        <p>(<strong>Anm</strong>:  <em>nihilisme</em>; (av lat. 'intet' og -isme) holdning til samfunnet som avviser normene i en gitt epoke eller gruppe; betegnelsen er oftest brukt i filosofi og sosiologi. <strong>Kilde</strong>: <a href="http://www.snl.no/nihilisme">Store norske leksikon</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/makt_og_demokratiutredningen.php">Makt og demokratiutredningen (mintankesmie.no)</a>.) </p>
        <h3><a name="dekonstruksjon_avslorer" id="dekonstruksjon_avslorer"></a>- Dekonstruksjon: Avslører motsigelser</h3>
        <p><a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770332.html">Dekonstruksjon: Avsl&oslash;rer motsigelser</a><br />
          nrk.no 16.4.2006<br />
        - Dekonstruksjon tar sikte p&aring; &aring; vise fram eller trevle fra hverandre motsigelser eller forskjeller i tekster. Teorien bygger p&aring; at teksten fors&oslash;ker &aring; skjule disse motsigelsene. Men tekstens mening er likevel basert p&aring; dem, sier Atle Kittang.</p>
        <p> Professor Atle Kittang ved Universitetet i Bergen blir intervjuet av Ane Farseth&aring;s. Kittang har arbeidet med dekonstruksjonen som teori siden slutten av 1960-tallet.</p>
          <p>            <strong>Derrida skapte dekonstruksjonen</strong><br />
            Mannen som skapte ordet &rdquo;dekonstruksjon&rdquo; p&aring; 1960-tallet, er den franske filosofien Jacques Derrida (1930-). P&aring; en konferanse i 1967 ga han ut tre b&oslash;ker som alle er viktige grunnlagstekster for dekonstruksjonen. (...) </p>
          <p>Les hele intervjuet ved &aring; f&oslash;lge lenkene nedenfor.</p>
          <p><strong>DEKONSTRUKSJON</strong> <br />            
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770332.html">Dekonstruksjon: Avsl&oslash;rer motsigelser</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770519.html">1. Et nytt ord p&aring; fransk</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770573.html">2. Mistankens lesem&aring;te</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770596.html">3. Derrida: filosof med litter&aelig;rt nedslag</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770730.html">4. Grammatologi: Tale versus skrift</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770780.html">5. Spr&aring;ksystemet: Et nettverk av forskjeller</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770882.html">6. &rdquo;Diff&eacute;rance&rdquo;: den lille forskjellen</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770947.html">7. Spr&aring;ket som spill</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1770988.html">8. Amerikansk merkevare</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1771022.html">9. De Man og forholdet til nykritikk</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1771096.html">10. De Man og nyretorikken</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1771112.html">11. Hva skiller kommentaren fra teksten?</a><br />
            <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1771131.html">12. &rdquo;Ingenting utenfor teksten&rdquo;?</a><br />
        <a href="http://www.nrk.no/nyheter/kultur/lesekunst/teorier/1771151.html">13. Dekonstruksjonen 30 &aring;r etter</a> (...)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/know_do_gap.php">The know-do gap (mintankesmie.no)</a>.)</p>
          <h3>- Diverse avisartikler/kommentarer</h3>
          <ul>
            <li><a href="http://www.dagbladet.no/nyheter/2005/06/05/433768.html">            Mysteriet Derrida</a></li>
          <li>              <a href="http://www.dagbladet.no/kultur/2005/06/13/434539.html">Lov, rett og dekonstruksjon</a></li>
          <li>              <a href="http://www.injuria.no/tema/artikkel179.html">Juss og litteratur</a>          </li>
          </ul>
          <h3><a name="kafkask_rettspleie" id="kafkask_rettspleie"></a>- Kafka-retspleje</h3>
          <p><a href="http://jyllands-posten.dk/opinion/leder/ECE5570794/kafka-retspleje/">Kafka-retspleje</a><br />
            jyllands-posten.dk 5.6.2013<br />
            Som udgangspunkt skal retsplejen foregå i fuld offentlighed. Det følger blandt andet af grundlovens paragraf 65 stk. 1: »I retsplejen gennemføres offentlighed og mundtlighed i videst muligt omfang.« Nu er der som bekendt ikke ret meget i grundloven, der kan tages helt bogstaveligt for pålydende, og udtrykket ”i videst muligt omfang” er da også et så elastisk begreb, at paragraffens karakter af uforpligtende hensigtserklæring bliver tydelig, men man kan vel også anføre, at kravet om åbenhed følger af almindelig sund fornuft.</p>
          <p> Franz Kafkas roman ”Processen”, hvor en mand anklages og dømmes uden at vide for hvad, står i bevidstheden som den ultimative absurditet, men dele af den danske retspleje begynder at minde betænkeligt om, hvad vi kan kalde kafkaske tilstande. Efterhånden er dørlukninger, dobbelte dørlukninger, referatforbud og navneforbud blevet så almindelige, at de mere er reglen end undtagelsen i enhver sag, som på den ene eller anden måde har offentlig interesse. (...) </p>
          <p>(<strong>Anm</strong>:  <em>What makes something &quot;Kafkaesque&quot;?</em> - Noah Tavlin (<a href="http://ed.ted.com/lessons/what-makes-something-kafkaesque-noah-tavlin?utm_source=TED-Ed+Subscribers&amp;utm_campaign=53b05ddeb7-2013_09_219_19_2013&amp;utm_medium=email&amp;utm_term=0_1aaccced48-53b05ddeb7-47264377">ed.ted.com</a>).)</p>
          <p>(<strong>Anm</strong>:  Fluer og  frihet i to Kafka-romaner. Norsk Litteratur­vitenskapelig. Franz Kafkas  forfatterskap er et yndet emne innenfor såkalte animal studies, en tverrfaglig  disiplin med forbindelser til litteraturvitenskapen.1 Særlig Kafkas kortprosa  innbyr til lesninger av denne sorten, ettersom dyr av ulike arter er sentrale i  disse fortellingene – enten det dreier seg om det lille skadedyret, Gregor  Samsa («Die Verwandlung»), eller om den mer antropomorfe apen, Rotpeter («Ein  Bericht für eine Akademie»). <a href="https://www.idunn.no/nlvt/2017/01/fluer_og_frihet_i_to_kafka-romaner">Tidsskrift  01 / 2017 (Volum 19) Side: 22-39</a>.)</p>
          <p>(<strong>Anm</strong>:  Det er  livsfarlig å stole på Facebook. (…) Det er <a href="http://erikstephansen.blogg.no/1445252995_kan_vi_stole_p_facebo.html">mange som har  blitt stengt ute</a>, og det er noen ganger vanskelig å vite  hvorfor.&nbsp;<em>Noen måtte ha baktalt Josef K., for en morgen ble han  arrestert uten at han hadde gjort noe galt. </em>- Franz Kafka, Prosessen. Ofte  blir folk utestengt <a href="https://www.nrk.no/kultur/frykter-facebook-knebler-ytringer-1.8357043">fordi de  rapporteres.</a> Fordi noen har baktalt dem. (<a href="http://nisja.blogg.no/1472107336_det_er_livsfarlig__st.html">nisja.blogg.no  25.8.2016</a>).)</p>
          <h3><a name="publikums_rettssikkerhet" id="publikums_rettssikkerhet"></a>- Afskåret fra retfærdig rettergang</h3>
          <p><a href="http://www.forbrugerraadet.dk/svar/alle/svar222/">Afsk&aring;ret fra retf&aelig;rdig rettergang<br />
          </a> Forbrugerr&aring;det 18.05.2004<br />
          Adgang til domstolene og en retf&aelig;rdig rettergang er en grundl&aelig;ggende v&aelig;rdi i et retssamfund. Men i Danmark har det l&aelig;nge v&aelig;ret et problem, at sagsbehandling ved domstolene er dyrt, langsomt, kompliceret og gammeldags. En p&aring;stand, som bakkes op af Den Danske Dommerforening.</p>
          <p>            Hvad nytter det, at <a href="http://www.lovdata.no/cgi-wift/ldles?doc=/all/nl-19990521-030.html#6">Menneskeretskonventionen paragraf 6</a> giver enhver ret til en retf&aelig;rdig rettergang, hvis omkostningerne er s&aring; h&oslash;je og processen s&aring; kompliceret, at almindelige borgere reelt er afsk&aring;ret fra at anvende domstolene? (...) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/saksomkostninger_menigmanns_ruin.php">Saksomkostninger (menigmanns ruin) (sakskostnader) (mintankesmie.no)</a>.)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/fattigdom_fordelingspolitikk_og_rikdom.php#styrk_rettshjelp">- Forskning viser en klar sammenheng mellom rettshjelpsbehov og fattigdomsproblemer - Ressurssvake når ikke frem i retten. (forskning.no 27.9.2011)</a>.)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.dagbladet.no/meninger/dbmener/">Jurister på barrikadene. De  dukker raskt opp på arenaen når enkeltpersoner eller grupper trenger bistand i  møte med statsmakten. (…)  Advokatene er  sinte. De mener at de tilbys usle lønnsvilkår når de gjør tjeneste for borgere  som av en eller annen grunn trenger bistand mot nettopp staten. (dagbladet.no  17.8.2015)</a>.)</p>
          <h3>- Sunshine Policies (retningslinjer for åpenhet om interessekonflikter) og mørke skygger over Europa: Offentliggjøring av legemiddelindustriens utbetalinger til helsepersonell i ni europeiske land. (- Er åpenheten om individuelle data obligatorisk og komplett? Flertallet av de frivillige retningslinjer inkluderer en "opt-out" (frameldelse)-klausul i form av et krav om individuelt samtykke, hvilket undergraver betydningen av en åpenhetspolitikk.)</h3>
          <p>(<strong>Anm</strong>: Sunshine Policies (retningslinjer for åpenhet om interessekonflikter) og mørke  skygger over Europa: Offentliggjøring av legemiddelindustriens utbetalinger til  helsepersonell i ni europeiske land. (Sunshine Policies and Murky Shadows in  Europe: Disclosure of Pharmaceutical Industry Payments to Health Professionals  in Nine European Countries. (...) Er åpenheten om individuelle data obligatorisk  og komplette? Flertallet av de frivillige retningslinjer inkluderer en  &quot;opt-out&quot; (frameldelse)-klausul, gjennom et krav om individuelt  samtykke, hvilket undergraver betydningen av en åpenhetspolitikk. (The majority of the voluntary codes include an “opt-out” clause, through a requirement for individual consent, that undermines the meaning of a transparency policy.) (...) Disclosure rules must follow EFPIA guidelines, but  exceptions are allowed when these provisions are in conflict with national laws  or regulations. <a href="http://www.mintankesmie.no/habilitet.php#sunshine_policies_apenhet_om_interessekonflikter">Int  J Health Policy Manag 2018 (ePublished: 14 March 2018)</a>.) </p>
          <p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/habilitet.php">Habilitet (integritet) (mintankesmie.no)</a>.)</p>
          <p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/media.php">Media (mediekritikk) (mintankesmie.no)</a>.) </p>
          <p> (<strong>Anm</strong>: <a href="http://www.mintankesmie.no/interessekonflikter_bestikkelser_og_korrupsjon.php">Interessekonflikter, bestikkelser og korrupsjon (mintankesmie.no)</a>.)          </p>
          <h3>- Det nærmeste du kan komme en Kafka-prosess.</h3>
          <p><a href="http://www.dagbladet.no/kultur/det-naermeste-du-kan-komme-en-kafka-prosess/67020437">Debatt:  Eritreere i Norge. Det nærmeste du kan komme en Kafka-prosess</a>.<br />
Arild Humlen, advokat (H)<br />
aftenposten.no 9.2.2017<br />
Flere hundre etniske eritreere lever rettighetsløse i Norge i dag, sultne og  uten rett til helsehjelp, uten utsikt til retur. </p>
          <p>I forbindelse med en nylig gjennomført hovedforhandling i  Oslo tingrett, kom det fram at en gruppe på flere hundre etniske eritreere, er  blitt underkastet en forvaltningsprosess av utlendingsmyndighetene, som må være  kroneksempelet på en «Kafka-prosess». Rettssikkerhet og god forvaltningsskikk  har forsvunnet ut av syne, fordi ønske om et bestemt utfall har vært styrende.<br />
            <br />
            Eritrea var fram til 1993 en region under etiopisk styre. I  1992 ble det gjennomført et referendum for alle etniske eritreere i Etiopia og  i verden for øvrig. De over 18 år kunne registrere seg som eritreere og delta i  valget. Disse fikk utstedt eritreiske id-kort, som eritreiske borgere. (…) </p>
          <p>(<strong>Anm</strong>:  Selvmordsbølge  blant mindreårige asylsøkere i Sverige. (…) – Det er mye stress. Det er  ensomhet og det er fremfor alt håpløshet. De vet ikke hva som venter dem, sier  Madadi. (<a href="http://www.aftenposten.no/verden/Selvmordsbolge-blant-mindrearige-asylsokere-i-Sverige-614836b.html">aftenposten.no  9.2.2017</a>).)</p>
          <p>(<strong>Anm</strong>:  UDI slår  alarm: – Det har vært flere selvmordsforsøk. UDI er bekymret for de unge  asylsøkerne som blir boende på mottak over lang tid. Det rapporteres om  selvskading, selvmordsforsøk, sosial isolasjon og nedstemthet. (…) – Mottakene  rapporterer om at de har opplevd en negativ utvikling hos flere ungdommer det  siste halvåret. Det handler om søvnproblemer, skolevegring, frustrasjon, sosial  isolasjon, nedstemthet, og noe aggresjon og utagering. Det betyr ikke at det er  slik på alle mottak, men det er summen av tilbakemeldingene vi har fått, sier  fagsjef i UDI, Edle Grønningsæter Pallum. (<a href="http://www.dagsavisen.no/innenriks/udi-slar-alarm-det-har-vert-flere-selvmordsforsok-1.923342">dagsavisen.no  9.2.2017</a>).)</p>
<h3>- Kritisk til at Faremo fjernet fri rettshjelp</h3>
          <p><a href="http://kommunal-rapport.no/artikkel/kritisk_til_at_faremo_fjernet_fri_rettshjelp">Kritisk til at Faremo fjernet fri rettshjelp</a><br />
kommunal-rapport.no 6.8.2013<br />
Modum-ordfører Terje Bråthen (Ap) oppfordrer justisministeren til å opprettholde lavterskeltilbudet om fri rettshjelp til kommunene.</p>
          <p> Da regjeringen i 2010 lanserte fri rettshjelp i 40 kommuner, var planen at tilbudet skulle utvides til å gjelde hele landet. Ved nyttår besluttet justisminister Grete Faremo (Ap) i stedet å legge ned prosjektet.</p>
          <p> Da regjeringen lanserte forsøksprosjektet med fri rettshjelp for kommunene i Buskerud og Rogaland, var planen at dette skulle danne utgangspunktet for et tilbud i hele landet. (...)</p>
<h3>- Franz Kafka: vår tids visjonær (- Kamp mot systemet)</h3>
          <p><a href="http://www.aftenposteninnsikt.no/kulturtrender/franz-kafka-v-r-tids-visjon-r">Franz  Kafka: vår tids visjonær</a>.<br />
aftenposten.no 1.4.2015<br />
For hundre år siden la Franz Kafka siste hånd på «Prosessen». I den ufullendte  romanen skildrer den tysk-jødiske forfatteren fra Praha vesenstrekkene ved den  allvitende moderne overvåkingsstaten.</p>
          <p><strong>Kamp mot systemet</strong>. Edward Snowdens avsløringer om  etterretningstjenesten NSA bekrefter en beklemmende sannhet: Protester fra  liberale kritikere til tross; det oppfattes ikke lenger som en altfor stor  skandale at staten organiserer seg mot sine egne borgere. Den fulle og hele  kontroll, og maktmisbruket i kjølvannet av den, aksepteres stilltiende nærmest  som en avansert form for nettverksbygging.</p>
          <p>Nettopp denne sammenhengen undersøkte Franz Kafka for 100 år  siden i «Prosessen», der en 30 år gammel mann ved navn Jozef K. havner i armene  på en slags parallelljustis som har forgrenet seg helt inn i hans nærmeste  omgivelser.</p>
          <p>Mens Snowden tar et ettertrykkelig oppgjør med systemet han  først var en del av, værer den sakesløse romanfiguren til å begynne med den  uhørte skandalen, men deretter svekkes han i troen på egen uskyld, og til slutt  ikke bare bukker han under for det allestedsnærværende, selvoppnevnte  justisapparatet, han bidrar selv til å fullbyrde dommen som etter alt å dømme  er felt over ham.</p>
          <p><strong>Intimitetstyveri</strong>. «Kafka var utvilsomt en pionér i å  diagnostisere de moderne maktformene», sier Kafka-biograf og litteraturviter  Reiner Stach om forfatterskapet til et av de største navnene i tysk litteratur.  «Terroren Jozef K. utsettes for i «Prosessen», er at man tar fra ham  privatlivet og intimiteten hans», sier han om romanen som åpner med at  hovedpersonen en morgen blir «arrestert uten at han hadde gjort noe galt.» (…) </p>
          <p><strong>Anonyme makter</strong>. Med Kafka godt under huden fortviler Reiner Stach over at man stadig kan høre folk si «jeg har da ikke noe å skjule» når de konfronteres med egen netthygiene, videoovervåking eller kommunikasjonskontroll: «Det er uendelig naivt!» sukker biografen som ser Kafkas visjonære gjennomtrengningskraft i dag komme til full anvendelse:</p>
          <p>I et brev til journalisten og venninnen Milena Jesenská drøfter Kafka i 1922 de moderne kommunikasjonsformenes vesen, hvilke av dem bør to mennesker som bor borte fra hverandre bruke, og hvilke ikke? Jernbane, bil og «areoplan»: ja. Telefon, telegraf og – i særdeleshet – trådløs telegrafi: nei. For ad disse veier kommer «de skrevne kyssene» til Milena slett ikke frem, hevder Kafka, nei, de blir «drukket opp av spøkelser på veien». (...)          </p>
          <p>(<strong>Anm</strong>:  <em>What makes something &quot;Kafkaesque&quot;?</em> - Noah Tavlin (<a href="http://ed.ted.com/lessons/what-makes-something-kafkaesque-noah-tavlin?utm_source=TED-Ed+Subscribers&amp;utm_campaign=53b05ddeb7-2013_09_219_19_2013&amp;utm_medium=email&amp;utm_term=0_1aaccced48-53b05ddeb7-47264377">ed.ted.com</a>).)</p>
          <p>(<strong>Anm</strong>:  Fluer og  frihet i to Kafka-romaner. Norsk Litteratur­vitenskapelig. Franz Kafkas  forfatterskap er et yndet emne innenfor såkalte animal studies, en tverrfaglig  disiplin med forbindelser til litteraturvitenskapen.1 Særlig Kafkas kortprosa  innbyr til lesninger av denne sorten, ettersom dyr av ulike arter er sentrale i  disse fortellingene – enten det dreier seg om det lille skadedyret, Gregor  Samsa («Die Verwandlung»), eller om den mer antropomorfe apen, Rotpeter («Ein  Bericht für eine Akademie»). <a href="https://www.idunn.no/nlvt/2017/01/fluer_og_frihet_i_to_kafka-romaner">Tidsskrift  01 / 2017 (Volum 19) Side: 22-39</a>.)</p>
          <p>(<strong>Anm</strong>:  Det er  livsfarlig å stole på Facebook. (…) Det er <a href="http://erikstephansen.blogg.no/1445252995_kan_vi_stole_p_facebo.html">mange som har  blitt stengt ute</a>, og det er noen ganger vanskelig å vite  hvorfor.&nbsp;<em>Noen måtte ha baktalt Josef K., for en morgen ble han  arrestert uten at han hadde gjort noe galt. </em>- Franz Kafka, Prosessen. Ofte  blir folk utestengt <a href="https://www.nrk.no/kultur/frykter-facebook-knebler-ytringer-1.8357043">fordi de  rapporteres.</a> Fordi noen har baktalt dem. (<a href="http://nisja.blogg.no/1472107336_det_er_livsfarlig__st.html">nisja.blogg.no  25.8.2016</a>).)</p>
<p>(<strong>Anm</strong>:  <a href="http://www.nrk.no/kultur/_-alle-som-tror-pa-demokrati-bor-takke-snowden-1.12315538">–  Alle som tror på demokrati bør takke Snowden. En av Edward Snowdens advokater,  Patrick Toomey, mener at datateknikerens avsløringer ikke har fått nok  anerkjennelse. (nrk.no 17.4.2015)</a>.)</p>
<p>(<strong>Anm</strong>:  Snowden  skuffet over den norske regjeringen. Her tar Edward Snowden imot den norske  Ossietzky-prisen på et hotellrom i Moskva – i stedet for i en storslått  seremoni i Oslo. – Jeg er skuffet over norske myndigheter, sier den berømte  varsleren. Den noe reduserte seremonien fant sted i Moskva på fredag i forrige  uke, på et hotellrom leid av ytringsfrihetsorganisasjonen Norsk Pen – som står  bak <a href="http://norskpen.no/nb_NO/ossietzkyprisen/" target="_blank">Ossietzky-prisen</a>.  (<a href="https://www.nrk.no/dokumentar/xl/snowden-skuffet-over-den-norske-regjeringen-1.13493806">nrk.no  29.4.2017</a>).)</p>
there is no attribute "target"
Line: 4354, Col: 487
…pen.no/nb_NO/ossietzkyprisen/" target="_blank">Ossietzky-prisen</a>. (<a href…
<h3>- For Franz Kafka var søvnløshet en litterær metode</h3>
<p><a href="http://www.thelancet.com/journals/laneur/article/PIIS1474-4422(16)30241-1/fulltext">For Franz  Kafka, insomnia was a literary method</a><br />
  Lancet neurology 2016;15(12):207 (November 2016<br />
  We read with great interest the Focal Point by Antonio Perciaccante and Alessia Coralli<a href="javascript:void(0);">1</a> about Franz Kafka's insomnia and parasomnias. For all his writing life, Kafka had insomnia and the hypnagogic hallucinations arising from his lack of sleep shaped much of his writing. However, to conclude, as the authors do, that “The Metamorphosis” can be read as a metaphor for ill effects of insomnia would be incorrect. </p>
<p>“I believe this sleeplessness comes only because I write”, Kafka noted in one of his diary entries in 1910.<a href="javascript:void(0);">2</a> In 1922, to Max Brod, he writes: “Perhaps there are other forms of writing, but I know only this kind; at night, when fear keeps me from sleeping, I know only this kind.”<a href="javascript:void(0);">3</a> As Aaron Mishara notes, for Kafka, writing is a trance-like Dionysian activity at night, opening the endless inner darkness of self as an abyss without an end.<a href="javascript:void(0);">4</a> Kafka, writing about one of his sleepless nights, mentions a great fire in which everything appears and disappears, which Mishara suggests represents a state of cortical excitability after his withdrawal from social stimuli with sleep deprivation. Kafka was eager for seperation from his family, with whom he spent much of his life (much like Gregor Samsa in The Metamorphosis, who also had a difficult relationship with his family).<a href="javascript:void(0);">5</a> Social withdrawal and photic withdrawal are essential for self-induced hypnagogic-like-trances. Kafka scheduled his writing during the night in a sleep-deprived state purposely because this state of prolonged sleep deprivation could serve as a psychotomimetic state (a psychotic-like state in an otherwise healthy individual). “It is not alertness but self-oblivion that is the precondition of writing”, Kafka writes to Max Brod.<a href="javascript:void(0);">3</a></p>
<p>Drawing from these and numerous other diary entries and letters, we pose that, even if Kafka was tortured by the incessant insomnia, it was his preferred and perhaps his only method of journeying (in Jungian terms) into the depths of his unconscious. His insomnia was not at all dehumanising (as suggested by Perciccante and Correlli), but the exact opposite—ie, humanising the self by bringing to surface elements of unconscious that guide most actions of our waking life. (…)</p>
<p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/sprak_sprakforstaelse_og_utdanning.php">Spr&aring;k, spr&aring;kforst&aring;else og utdanning (mintankesmie.no)</a>.)</p>
<h3>- Et kafkask helvete (- De er unge og aktive, men pludselig magter de intet.) </h3>
          <p><a href="http://politiken.dk/forbrugogliv/sundhedogmotion/sygdom/ECE2604087/efter-voldsom-kritik-hjaelp-paa-vej-til-unge-kvinder-med-smerter-efter-vaccine/?ref=nyhedsbrev_politiken-morgen&amp;utm_source=Politiken&amp;utm_medium=newsletter&amp;utm_campaign=politiken-morgen">Efter  voldsom kritik: Hjælp på vej til unge kvinder med smerter efter vaccine</a><br />
            politiken.dk 25.3.2015<br />
            Fem sygehuse specialiseres i at hjælpe unge kvinder med alvorlig sygdom, der  kan skyldes vaccine mod livmoderhalskræft.</p>
          <p> De er unge og aktive, men pludselig magter de intet.  Invaliderende svimmelhed, træthed og massive hovedpiner dræner dem. </p>
          <p>I flere år har hundredvis af unge kvinder og deres forældre  kæmpet for at få det etablerede sundhedsvæsen til at tage symptomer, der måske  skyldes bivirkninger af hpv-vaccinen mod livmoderhalskræft, alvorligt. </p>
          <p>Og efter år med voldsom kritik er Danske Regioner nu klar  med et tiltag på området, så der senest 1. juni er én hospitalsafdeling i hver  af landets fem regioner, der skal tage sig af patienter med uklare symptomer,  som kan være resultat af bivirkninger ved hpv-vaccinen. (…) </p>
          <p> <strong>Læge: »Et kafkask helvede«</strong></p>
          <p>Synkopecenteret på Frederiksberg Hospital er det sted, hvor  piger fra Region Hovedstaden skal starte deres udredningsforløb. Læge Louise  Brinth fra Synkopecenteret har skrevet Kroniken i dagens avis. Hun støtter  hpv-vaccinen, men har set mere end 80 piger, der alle har oplevet diffuse  symptomer med invaliderende træt- og svimmelhed: (…) </p>
          <p><strong>Louise Brinth tror, at regionernes nye tiltag vil kunne være  med til at sikre, at »tilliden til vaccinen er bedst muligt langtidssikret. Det  er ikke langtidsholdbart at tie den her bekymring ihjel«. </strong></p>
          <p>Mette Kenfelts datter Simone fik, som Politiken beskrev i  2013, sværere invaliderende bivirkninger, angiveligt fra hpv-vaccinen. To års  skolegang er mistet: </p>
          <p>»Det er dejligt, hvis der nu sker noget. Vi bliver nødt til  at tage de her ellers sunde, raske unge pigers sygdomme alvorligt«. (...)          </p>
          <p>(<strong>Anm</strong>:  <em>What makes something &quot;Kafkaesque&quot;?</em> - Noah Tavlin (<a href="http://ed.ted.com/lessons/what-makes-something-kafkaesque-noah-tavlin?utm_source=TED-Ed+Subscribers&amp;utm_campaign=53b05ddeb7-2013_09_219_19_2013&amp;utm_medium=email&amp;utm_term=0_1aaccced48-53b05ddeb7-47264377">ed.ted.com</a>).)</p>
          <p>(<strong>Anm</strong>:  Fluer og  frihet i to Kafka-romaner. Norsk Litteratur­vitenskapelig. Franz Kafkas  forfatterskap er et yndet emne innenfor såkalte animal studies, en tverrfaglig  disiplin med forbindelser til litteraturvitenskapen.1 Særlig Kafkas kortprosa  innbyr til lesninger av denne sorten, ettersom dyr av ulike arter er sentrale i  disse fortellingene – enten det dreier seg om det lille skadedyret, Gregor  Samsa («Die Verwandlung»), eller om den mer antropomorfe apen, Rotpeter («Ein  Bericht für eine Akademie»). <a href="https://www.idunn.no/nlvt/2017/01/fluer_og_frihet_i_to_kafka-romaner">Tidsskrift  01 / 2017 (Volum 19) Side: 22-39</a>.)</p>
<h3>- Vaksiner blir grundigere undersøkt enn noen andre typer medisin</h3>
          <p><a href="http://www.aftenposten.no/meninger/debatt/Kjare-foreldre-Dere-blir-loyet-til-7589252.html">Kjære  foreldre. Dere blir løyet til</a><br />
            Jennifer Raff, postdoktor ved The University  of Texas<br />
            aftenposten.no 4.6.2014<br />
            Er du redd for å gi barnet ditt vaksine? Du bør heller være redd for å la være,  skriver postdoktor Jennifer Raff.</p>
          <p>Vaksinemotstandere lyver til deg. Vaksiner er en av våre aller  største oppnåelser innen helse, og en av de aller viktigste tingene du kan  gjøre for barnet ditt, skriver innleggsforfatteren. </p>
          <p>Sett i lys av de <a href="http://pediatrics.about.com/od/measles/a/measles-outbreaks.htm">nylige utbruddene</a> av meslinger og andre sykdommer som kan  forebygges med vaksine, og av at anti-vaksineaktivistene nekter å anerkjenne  problemet, tenkte jeg det var på høy tid å skrive dette innlegget.</p>
          <p><strong>Kjære foreldre,</strong></p>
          <p><a href="http://www.forbes.com/sites/emilywillingham/2014/03/23/worried-about-measles-dont-call-dr-bob-sears/">Dere blir  løyet til</a>. <br />
            Menneskene som påstår at de handler i deres barns beste interesse setter i virkeligheten  barnas helse, til og med deres liv, <a href="http://www.weather.com/health/just-prick-origin-and-evolution-anti-vaccine-movement-20140228?cm_ven=Twitter">i fare</a>.</p>
          <p>De sier at meslinger ikke er en dødelig sykdom.<br />
            Men&nbsp;<a href="http://www.who.int/mediacentre/factsheets/fs286/en/">det er den</a>.</p>
          <p>De sier at vannkopper ikke er spesielt farlig. <br />
            Men det kan&nbsp;<a href="http://www.cdc.gov/vaccines/vpd-vac/varicella/default.htm">det være</a>.</p>
          <p>De sier at influensa ikke er farlig.<br />
            Men det&nbsp;<a href="http://www.cdc.gov/flu/index.htm">er det</a>.</p>
          <p>De sier at kikhoste ikke er så ille for barn å få.<br />
            Men&nbsp;<a href="http://www.cdc.gov/features/pertussis/">er det</a>.</p>
          <p>De sier at vaksiner ikke er så effektive mot sykdom. Men vaksiner redder  tre millioner barneliv <a href="http://www.ncbi.nlm.nih.gov/pubmed/10559545">hvert år</a>, mens to millioner årlig dør av sykdommer som  vaksiner <a href="http://www.ncbi.nlm.nih.gov/pubmed/10559545">kunne forhindret</a>.</p>
          <p>De sier at en «naturlig smitte» er bedre enn vaksine.<br />
            Men de tar <a href="http://www.immunizationinfo.org/issues/exposure-parties/measles-parties">tar feil</a>.</p>
          <p>De sier at vaksiner ikke har blitt grundig testet for om de kan være  farlige. Men vaksiner&nbsp;<a href="http://pediatrics.aappublications.org/content/123/1/e164.full">blir grundigere undersøkt enn noen andre typer medisin.</a> (…) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/bivirkninger_og_bivirkningsovervakning.php">Bivirkninger og bivirkningsoverv&aring;kning (legemiddelsikkerhet) (mintankesmie.no)</a>.) </p>
          <p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/vaksiner.php">Vaksiner  (mintankesmie.no)</a>.)</p>
<p>(<strong>Anm</strong>:  Skader og  ulykker i Norge. 2500 dør og 300 000 behandles årlig på sykehus for skader.  Mange alvorlige skader er knyttet til alkohol og andre rusmidler, fall og  trafikk. (…) Hva er et forgiftningsdødsfall? (<a href="http://www.mintankesmie.no/sykehus_forvaltning_skader_dodstall_og_kvalitet.php#hva_er_et_forgiftningsdodsfall">fhi.no  14.12.2016</a>).)                      </p>
<p>(<strong>Anm</strong>:  Medisinske feil — den tredje viktigste dødsårsaken i USA. Hvert år oppstår mer enn 250 000 dødsfall i USA som et resultat av medisinske feil. Medisinske feil inkluderes ikke i dødsattester eller i rangeringen av dødsårsaker. (Medical error—the third leading cause of death in the US.) <a href="http://www.mintankesmie.no/sykehus_forvaltning_skader_dodstall_og_kvalitet.php#den_tredje_viktigste">BMJ 2016;353:i2139 (Published 03 May 2016</a>).)</p>
          <h3><a name="fungerer_ikke" id="fungerer_ikke"></a>- Advokater: Retshjælpen fungerer ikke</h3>
          <p><a href="http://www.b.dk/nationalt/advokater-retshjaelpen-fungerer-ikke">Advokater: Retshjælpen fungerer ikke</a><br />
            b.dk 23.3.2011<br />
            Landets advokater slår nu alarm over retssikkerheden for almindelige borgere i Danmark.</p>
          <p> Landets advokater slår nu alarm over retssikkerheden for almindelige borgere i Danmark, for selv om vi herhjemme bryster os af et retssamfund, hvor alle er »lige for loven« og kan få prøvet uretfærdigheder ved retten, er det ikke tilfældet i praksis. Forklaringen: Retshjælpsordningerne fungerer ikke.</p>
          <p> Udmeldingen kommer fra Advokatrådet og brancheforeningen Danske Advokater. De har fået lavet en undersøgelse blandt mere end 1.800 advokater om deres syn på henholdsvis retshjælpsforsikringer, som næsten 90 pct. af befolkningen er dækket af, og den offentlige retshjælp og fri proces-ordning, som gælder for borgere med særlig lav indkomst. (...) </p>
          <p><strong>Sager kan ikke finansieres</strong><br />
            To af de advokater, der jævnligt tager retshjælpssager, oplever konsekvenser for sagernes mulighed igennem systemet. Advokat Karsten Høj fra Elmer &amp; Partnere forklarer, at han dagligt må fortælle klienter, at de vil være bedre stillet ved at lave »et halvdårligt forlig«, fordi de ikke kan få finansieret en retssag. Samme melding kommer fra advokat Jakob Dalsgaard-Hansen fra Hovmøller &amp; Thorup:</p>
          <p> »Der kan være sager, hvor der helt åbenbart er sket en uret, men hvor finansieringen bare ikke er der til at føre sagen. Der er jo sagsomkostninger, inden man overhovedet ved, om man kan få retshjælpsforsikring, fordi man skal have bevis for, at man har en sag. Det kan være, at man skal have en håndværker eller arkitekt ud for at se på et hus,« siger han.</p>
          <p> I forsikringsselskabernes brancheorganisation, Forsikring&amp;Pension, understreger advokat Gitte Danelund, at branchen ikke ser tegn på problemer med den nuværende ordning. (...) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/lover_lovdata_og_rettssikkerhet.php">Lover (lovdata.no) og rettssikkerhet (mintankesmie.no)</a>.) </p>
          <h3>- Hvordan kan vanlige folk n&aring; frem i retten med sine saker, uten &aring; bli ruinert av en kostbar full rettergang?</h3>
          <p><a href="http://www.aftenposten.no/meninger/leder_morgen/article1350810.ece">Rettens pris</a><br />
Leder<br />
aftenposten.no 14.6.2006<br />
Hvordan kan vanlige folk n&aring; frem i retten med sine saker, uten &aring; bli ruinert av en kostbar full rettergang? Den &oslash;konomiske belastning er for de fleste s&aring; tung at dette er et demokratisk problem, ettersom fri rettshjelp ikke er en allemannsrett. (...)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/saksomkostninger_menigmanns_ruin.php">Saksomkostninger (menigmanns ruin) (sakskostnader) (mintankesmie.no)</a>.)</p>
          <p><a href="http://www.nrk.no/nyheter/okonomi/1.3830415">En tredel av oss dropper advokat</a><br />
            nrk.no 24.10.2007 <br />
            En tredjedel av befolkningen har vurdert &aring; bruke advokat de siste tre &aring;rene, men de har latt v&aelig;re p&aring; grunn av prisen. </p>
          <p> Det viser en unders&oslash;kelse Opinion har gjennomf&oslash;rt for Help Forskring, et selskap som har spesialisert seg p&aring; rettshjelpsforsikring. </p>
          <p> En tredjedele av de spurte i unders&oslash;kelsen svarer at de har brukt advokat den siste tre&aring;rsperioden. </p>
          <p> Av disse har seks prosent, eller 72.000 personer, brukt mer enn 100.000 kroner p&aring; advokat privat. (...) </p>
          <p>P&aring; et seminar om advokatbruk og rettssikkerhet i Oslo i dag, sa Forbrukerr&aring;det at de ser et behov for rettshjelpsforsikringer i Norge. (...) </p>
          <p><a href="http://www.ukeavisenledelse.no/etikk_og_samfunnsansvar/20071024/blank/">&ndash; Kutt i rettshjelpen</a><br />
  ukeavisenledelse.no 24.10.2007 <br />
  Advokatforeningen mener at innsnevring av regelverket reduserer tilbudet om fri rettshjelp.</p>
          <p>Justisdepartementet vil neste &aring;r foresl&aring; &aring; bruke 94 millioner kroner mindre p&aring; fritt rettsr&aring;d enn i 2004, tilsvarende en reduksjon p&aring; 37 prosent, skriver V&aring;rt Land onsdag. </p>
          <p> Fritt rettsr&aring;d er en del av fri rettshjelp, og inneb&aelig;rer advokatkonsultasjon f&oslash;r en rettssak. Bevilgningene til fri rettshjelp styres ut fra hvor mange som har krav p&aring; slik hjelp. </p>
          <p> Innsnevringene i regelverket gj&oslash;r det umulig for mange fattige &aring; f&aring; hjelp f&oslash;r de skal i en rettssak, mener Advokatforeningen. (...) </p>
          <h3>- Domstolen er menigmanns ruin</h3>
        <p><a href="http://www.aftenposten.no/meninger/kronikker/article1021495.ece">Domstolen er menigmanns ruin</a> (<a href="http://mintankesmie.no/minrome/domstolen_er_menigmanns_ruin.pdf">PDF</a>) <br />
            KRONIKK. 
Tor A. Fusdahl, Advokat<br />
aftenposten.no 19.4.2005<br />
        <strong>R&Aring;TT PARTI</strong>. Den som ikke n&aring;r frem i retten m&aring; betale motpartens saksomkostninger, som gjerne blir skyh&oslash;ye. Dette gj&oslash;r menige borgere bortimot rettsl&oslash;se, fordi det for dem betyr &oslash;konomisk ruin &aring; tape en sak. Loven m&aring; endres, skriver artikkelforfatteren.</p>
          <p>KOSTBAR RETTSSIKKERHET. Rettssaker koster penger. Mange penger. Saker koster n&aring; s&aring; meget at vanlige folk er fratatt den forutsatte grunnlovsbestemte rett til &aring; f&aring; en sak pr&oslash;vet.</p>
          <p>Vi har alle sett i avisene at personer som fors&oslash;ker &aring; vinne rett til skadeserstatninger ved ulykker, erstatninger hvor de er skadet av sykehus eller andre offentlige &quot;vesener&quot;, oppsagt fra stilling - osv - har blitt utsatt for advokat- og rettskostnader p&aring; hundretusener av kroner - enkelte p&aring; en million eller mer. Vi har brannofre hvor forsikringsselskap har nektet &aring; dekke skade hvor vedkommende har st&aring;tt uten hus og hjem, og i tillegg blitt p&aring;lagt enorme saksomkostninger. Det kommer oftest en slik sak i nyhetene annenhver uke hvor vedkommende har blitt utsatt for behandling i rettsvesenet i strid med folks alminnelige rettsbevissthet.</p>
          <p><strong>Sta og modig.</strong><br />
        I dag m&aring; den med vanlig formue og inntekt v&aelig;re usedvanlig trassig - og modig hinsides vanlig fornuft - om han vil s&oslash;ke sin rett mot et forsikringsselskap, aksjeselskap, offentlig etat eller lignende. Resultatet har blitt at vanlig folk, som har lidt alvorlig skade eller blodig urett, ikke t&oslash;r &aring; g&aring; til rettsvesenet for &aring; f&aring; pr&oslash;vet sin rett.</p>
          <p>Reglen i tvistem&aring;lsloven i dag er at den som taper sin sak - og det er det alltid mulighet for - ikke bare m&aring; dekke sine &quot;egne&quot; omkostninger, men ogs&aring; motpartens. For &aring; legge spott til skade har staten gjort situasjonen enda verre enn den var. Dette ved &aring; legge p&aring; merverdiagift p&aring; 25 % p&aring; toppen av omkostningene til advokater og i tillegg &aring; &oslash;ke rettsgebyrene dramatisk siste &aring;r.</p>
          <p>Situasjonen er n&aring; slik at forholdet mellom partene i en typisk sak er endret til vesentlig &aring; favorisere motparter som er firmaer, forsikringsselskaper, statlige etater osv. Situasjonen kan kort beskrives ved at rettsvesenet i dag st&aring;r for massiv urett mot folk flest. (...) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/saksomkostninger_menigmanns_ruin.php">Saksomkostninger (menigmanns ruin) (sakskostnader) (mintankesmie.no)</a>.)</p>
          <h3>- Rettssikkerheten trues</h3>
          <p><a href="http://www.retriever-info.com/no/">Rettssikkerheten trues</a><br />
            Haakon Utne Kierulf - advokat<br />
            aftenposten.no 28.12.2013<br />Advokathonorar. Ønsker
            vi en utvikling der penger
            avgjør hva som er rettferdig
            i en rettssak?</p>
          <p>Sør-Trøndelag tingrett reduserte nylig en advokats
            salærkrav i en arbeidsrettssak med et millionbeløp.
            Rettens avgjørelse illustrerer hvordan
            advokaters salærer truer rettssikkerheten, og at
            domstolsapparatet har en viktig funksjon for å
            hindre en slik utvikling.</p>
          <p> Da jeg startet egen advokatpraksis var tommelfingerregelen
            at en dag i retten tilsvarte cirka
            tre dagers arbeid totalt. Med en slik beregning
            skulle salæret blitt satt til 1,4 millioner kroner i
            nevnte sak – rundt 1,7 millioner under advokatens
            krav. I dette tilfellet ble salæret satt enda lavere, etter
            en konkret vurdering. Dommerens inngripen
            synes fornuftig, og noe tilsvarende burde kanskje
            gjøres i større omfang enn det som faktisk skjer.</p>
          <p> <strong>Stiller mannsterke</strong><br />
            Problemet med høye advokatsalær kan ligge i omfattende
            behandling før saken den ender i rettsapparatet,
            men også i hvordan advokatfirmaene
            organiserer sitt arbeid. Både som privatpraktiserende
            og organisasjonsadvokat har jeg opplevd å
            møte alene med min klient i saker med enkle juridiske
            spørsmål. Hos motparten er det ikke bare
            daglig leder, avdelingsleder, personalkonsulent
            og gjerne en juridisk rådgiver som møter opp.
            Ofte har de også med seg en advokat med partnertittel
            i et stort advokatfirma. Og partneren har
            ofte med seg en advokat. Om vedkommende stiller
            som rådgiver for mine motparter eller for sin
            partner er usikkert.</p>
          <p> I disse sakene spør jeg meg ofte om den aktuelle
            partneren har påtatt seg et oppdrag vedkommende
            ikke skulle sagt ja til. Enten fordi han manglet
            kompetanse – eller ikke hadde tid. Uansett virker
            det urimelig at en part i retten må dekke slike
            unødvendige utgifter på motpartens side.
            Risikoen for å bli dømt til å betale motpartens
            høye salærer kan hindre at saker som bør kommer
            opp for retten bringes inn. Det er uheldig.
            Vårt rettssystem sikrer at 50 prosent av de sakene
            som avgjøres i domstolene gir en av partene rett.
            Hvis salærkravene fra de store advokatfirmaene
            blir retningsgivende, uten at domstolene griper
            inn, vil det føre til at en rekke saker som ville fått
            en riktig avgjørelse i rettssystemet ikke får det. Og
            da blir det den ene partens tilgang på penger som
            gir rettferdighet. Ønsker vi en slik fortsatt utvikling?</p>
          <p> <strong>Retningslinjer for salær</strong><br />
            For å unngå dette må det fastsettes en timesats
            som begge parter kan forholde seg til ved et eventuelt
            salærkrav fra motparten. Satsen må være så
            høy at den ikke oppfordrer til rettslige tvister, og
            så lav at det forblir en realitet å få prøvd opplevd
            urett av domstolen.</p>
          <p> I tillegg må private parter få trekke fra utgiften
            på egen inntekt. Det kan begrense kostnaden ved
            å gå til sak, samtidig som partene likestilles skattemessig.<br />
            Lovgiver kan også angi noen retningslinjer
            for hvordan salæret skal fastsettes når det
            gjelder tidsbruken – og kanskje i forhold til tvistesummen.
            Med dagens raske informasjonsflyt og gode tilgang
            på rettskilder, er det tankevekkende at sakene
            allikevel blir stadig mer omstendelige. Både
            advokater og domstoler har her et ansvar. Det ansvaret
            tok Sør-Trøndelag tingrett.
            (...) </p>
          <h3>- Lovens makt. Autoritetens mystiske grunnlag</h3>
          <p> <a href="http://www.bokkilden.no/ProductDetails.aspx?http://www.spartacus.no/index.php?ID=Bok&amp;ID2=Vis&amp;counter=202">Lovens makt autoritetens mystiske grunnlag</a> (Jacques Derridas. Force de loi. Le &rdquo;Foundement mystique de l&rsquo;autoritet&eacute;&rdquo;)<br />
  (...) Det Staten, retten med den st&oslash;rste makt, frykter, er ikke s&aring; mye kriminaliteten eller forbrytelsene, selv ikke i stor skala som mafiaen eller den store narkotika handelen s&aring; lenge de bryter loven med sikte p&aring; bestemte gevinster, hvor store de enn m&aring;tte v&aelig;re. (Det er sant at i dag har disse kvasi-statlige og internasjonale organisasjonene en mer radikal status enn vanlig kriminalitet, og representerer en trussel mange stater ikke finner annen en l&oslash;sning p&aring; enn &aring; alliere seg med den &ndash; ved &aring; underkaste seg den, for eksempel gjennom fordelen med &rdquo;hvitvasking av penger&rdquo; &ndash; samtidig som de later som om de bekjemper den med alle midler.) </p>
          <p>Staten frykter den grunnleggende volden, som er i stand til &aring; rettferdiggj&oslash;re, begrunne (begr&uuml;nden) eller forandre rettsforholdene (Rechtsverh&auml;ltnisse), og dermed til &aring; fremstille seg selv som om den har en rett til retten. Denne volden tilh&oslash;rer slik p&aring; forh&aring;nd en rettsorden som det gjenst&aring;r &aring; forandre eller grunnlegge, selv om den kan skade rettferdighetssansen v&aring;r (Gerechtigkeitsgef&uuml;hl).<sup>29</sup> Bare denne volden kaller p&aring; og gj&oslash;r mulig en &rdquo;kritikk av volden&rdquo; som bestemmer denne som noe annet enn den naturlige ut&oslash;velsen av makt. For at en kritikk, det vil si en fortolkende og betydningsfull evaluering av volden skal v&aelig;re mulig, m&aring; man f&oslash;rst anerkjenne mening i en vold som ikke er et uhell som kommer fra et sted utenfor retten. Det som truer retten, tilh&oslash;rer allerede retten, rettens rett, rettens opphav. (...) </p>
          <p>(<strong>Anm</strong>:  <em>kvasi</em> (av lat. quasi, 'liksom'), uekte; mest brukt i sammensetninger for &aring; betegne at noe bare tilsynelatende er det som det andre leddet betegner, f.eks. <em>kvasil&aelig;rd</em>, halvl&aelig;rd, <em>kvasivitenskapelig</em>, bare tilsynelatende vitenskapelig. (...) </p>
          <p> <em>kontekst</em> (av kon- og lat. 'veve'), sammenheng, s&aelig;rlig den sammenhengen som et ord eller et uttrykk forekommer i. (...)</p>
          <p> <em>kontekstuell</em>, som gjelder en kontekst, som forekommer innenfor en kontekst.<strong> Kilde</strong>: <a href="http://www.snl.no/kontekstuell">Store norske leksikon</a>.)</p>
          <h3><a name="betalt_bestikkelser_til" id="betalt_bestikkelser_til"></a> - Én av 25 sier de har betalt bestikkelser til norsk rettsvesen</h3>
          <p><a href="http://www.nettavisen.no/nyheter/article3647979.ece">Én av 25 sier de har betalt bestikkelser til norsk rettsvesen</a><br />
  nettavisen.no 10.7.2013<br />
  I en ny, stor internasjonal undersøkelse om korrupsjon hevder 4 prosent av de spurte i Norge at de har betalt bestikkelser til personer i det norske rettsvesenet. </p>
          <p> – Jeg synes det er overraskende, og svært alvorlig, hvis dette stemmer, sier politiadvokat Jul Fredrik Kaltenborn i Økokrim til Aftenposten. Han kjenner ikke til noen eksempler på bestikkelser som skal ha foregått i det norske rettsvesenet. </p>
          <p> Det er i en større undersøkelse om korrupsjon verden over, gjennomført av antikorrupsjonsorganisasjonen Transparency International, at tallene kommer fram. </p>
          <p> I undersøkelsen svarer 3 prosent av de spurte i Norge at de har betalt bestikkelser i kontakt med offentlige institusjoner og tjenester i løpet av det siste året. To av fem nordmenn sier også at de tror det foregår korrupsjon i politiske partier, medier og privat sektor. </p>
          <p> – Jeg ble overrasket over det høye antallet som har betalt bestikkelser i Norge. Det viser oss at alle sektorer er sårbare for korrupsjon, sier Guro Slettemark, generalsekretær i Transparency International Norge. </p>
          <p> Norge kommer likevel langt ned på listen internasjonalt, der hele 27 prosent svarer at de har betalt bestikkelser den siste året. I Danmark og Finland ligger andelen på bare 1 prosent, mens Sverige ikke er med i undersøkelsen. (©NTB) </p>
          <p>(<strong>Anm</strong>:  <a href="http://transparency.no/">Transparency International Norge (transparency.no.)</a> </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/interessekonflikter_bestikkelser_og_korrupsjon.php">Interessekonflikter, bestikkelser og korrupsjon (mintankesmie.no)</a>.) </p>
<p>(<strong>Anm</strong>:  Når er et synspunkt en interessekonflikt? (When is a point of view a conflict of interest?) <a href="http://www.mintankesmie.no/statlig_legemiddelkontroll.php#et_synspunkt">BMJ 2016;355:i6194 (Published 23 November 2016)</a>.)                       </p>
					  <p>(<strong>Anm</strong>:  Høyresiden har  størst mistillit til journalistikken. (…) Videre mente 63 prosent at  journalister favoriserer kilder som mener det samme som dem. (<a href="http://www.mintankesmie.no/media.php#journalister_favoriserer_kilder">aftenposten.no  13.2.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  Mina Ghabel  Lunde, journalist. Når kilder også er venner. Pressen skal unngå bindinger som skaper usikkerhet om lojalitet. Da kan  ikke journalister omgås sine kilder privat. (<a href="http://www.mintankesmie.no/media.php#nar_kilder_ogsa_er_venner">aftenposten.no  8.2.2017</a>).) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/gratis_lunch_legemidler_gradighetskultur_og_korrupsjon.php#ingen_gratis_lunsj">Ingen  gratis lunsj for leger: Sponsede m&aring;ltider knyttet til flere resepter (No free  lunch for docs: Sponsored meals linked to more prescriptions) (mmm-online.com  20.6.2016)</a>.) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/habilitet.php">Habilitet (integritet) (mintankesmie.no)</a>.)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/dommere_og_domstoler.php#dommere_omgar_loven">VG:  Norske dommere omgår loven - dropper å registrere egne aksjekjøp (dn.no  5.9.2016)</a>.)          </p>
          <p>(<strong>Anm</strong>:  <a href="http://e24.no/eiendom/bdo-gransker-tar-ikke-oekonomisk-kriminalitet-paa-alvor/22635659">- Tar ikke økonomisk kriminalitet på alvor (e24.no 18.11.2013 )</a>.)</p>
          <h3>- Stadig mer vaskes hvitt</h3>
          <p><a href="http://www.ukeavisenledelse.no/meninger/redaktorens_mening/20080811/tom_kasse_i_okokrim/?utm_medium=epost&amp;utm_source=nyhetsbrev_ul&amp;utm_campaign=trafikk&amp;term=nyhetssak&amp;utm_content=lesmer">Tom kasse i &Oslash;kokrim</a><br />
  ukeavisenledelse.no 11.8.2008<br />
  N&aring;r Fast ikke blir etterforsket for &aring; ha manipulert regnskapet og lurt aksjon&aelig;rer og samarbeidspartnere, f&aring;r politikerne godta at grunnen er at det ikke er kapasitet. Det blir ikke sterkere bekjempelse av hvitsnippkriminalitet uten &oslash;kte bevilgninger, skriver Magne Ler&oslash;. (...) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/bank_bors_og_finans.php">Bank, b&oslash;rs og finans. (mintankesmie.no)</a>.)</p>
					  <p>(<strong>Anm</strong>:  Utilstrækkeligt tilsyn, utilstrækkeligt fokus og mangel på viden: Her er konklusionerne i lækket rapport om dansk hvidvask-indsats. FATF langer kraftigt ud efter bankerne og Finanstilsynet. Brancheorganisationen FinansDanmark påpeger, at hvidvask er højprioritet i bankerne. (<a href="https://jyllands-posten.dk/protected/premium/erhverv/ECE9300717/utilstraekkeligt-tilsyn-utilstraekkeligt-fokus-og-mangel-paa-viden-her-er-konklusionerne-i-laekket-rapport-om-dansk-hvidvaskindsats/">jyllands-posten.dk 19.1.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/politikk_politikere_og_troverdighet.php#eier_aksjer">Statlige  ansatte eier aksjer i selskaper de skal vokte. Oslo (NTB): Flere ansatte i  eierskapsavdelingen i Næringsdepartementet har aksjer i de samme selskapene som  avdelingen har ansvaret for å følge opp. (adressa.no 14.4.2016)</a>.)</p>
          <p><a href="http://www.dinside.no/php/art.php?id=494000">Norges verste hvitsnippforbrytere</a><br />
  dinside.no 27.10.2007 <br />
  Flere milliarder kroner er g&aring;tt tapt i &oslash;konomisk kriminalitet de siste &aring;rene. </p>
          <p>- Det har v&aelig;rt en &oslash;kning i antall anmeldelser som g&aring;r p&aring; &oslash;konomisk kriminalitet, sier Mie Skarpsno, informasjonskonsulent i &Oslash;kokrim til DinSide. - Det betyr ikke at det har v&aelig;rt en &oslash;kning i antallet forhold, men at det kanskje er en st&oslash;rre bevissthet omkring &oslash;konomisk kriminalitet. Det vi imidlertid ser er at sakene er st&oslash;rre og mer sofistikerte, og har internasjonale forgreninger, gjerne til skatteparadiser. Slike saker krever mer etterforskning og det krever ressurser og tid. (...) </p>
          <p><a name="farre_hvitsnipper_dommes" id="farre_hvitsnipper_dommes"></a><a href="http://www.na24.no/naeringsliv/article1348194.ece">F&aelig;rre hvitsnipper d&oslash;mmes</a><br />
  na24.no 27.10.2007 <br />
  Den typiske hvitsnippsforbryteren er en mann i tredve&aring;rene. </p>
          <p>I fjor ble 1635 personer d&oslash;mt for &oslash;konomisk kriminalitet i Norge. Det er en nedgang fra &aring;ret f&oslash;r p&aring; 11 prosent da 1846 personer ble d&oslash;mt for denne typen kriminalitet. (...) </p>
          <p><a href="http://www.retriever-info.com/no/">Mer hvitsnipp-krim - Men &Oslash;kokrim etterlyser tips fra aksjemeglere om juks</a><br />
  aftenposten.no 21.08.2007 <br />
&Oslash;kokrim har etter- forsket like mange hvitvaskings- og innside- saker i f&oslash;rste halv&aring;r i &aring;r som i hele fjor. (...) </p>
          <p><a href="http://ukeavisenledelse.no/cgi-bin/ukeavisen/imaker?id=193885">Hvitsnippene slipper for lett</a><br />
  ukeavisenledelse.no 21.8.2006<br />
  Politiinspekt&oslash;r Dag Styrvold mener manglende satsing p&aring; bekjempelse av &oslash;konomisk kriminalitet f&oslash;rer til at loven ikke er lik for alle. </p>
          <p>Styrvold har ledet &Oslash;kokrims arbeid med &aring; &oslash;ke kompetansen p&aring; &oslash;konomisk kriminalitet i politidistriktene. Dette arbeidet er n&aring; avsluttet, etter p&aring;legg fra Politidirektorartet. (...)</p>
          <p> &ndash; Gjerningsmennene i &oslash;konomisaker er ofte av de mer privilegerte i samfunnet. De har bedre sosial posisjon og &oslash;konomi enn sm&aring;kriminelle og rusmisbrukere. De har i st&oslash;rre grad et valg enn innbruddstyver og narkomane som politiet med stor effektivitet g&aring;r etter. Loven er ikke lik for alle. Ingen politifolk liker den slags klassejustis, sier han til avisen. </p>
          <p> Politiinspekt&oslash;ren mener ogs&aring; satsingen p&aring; &aring; ta hverdagskriminelle fremfor hvitsnippforbryterne er paradoksal.</p>
          <p>&ndash; Hverdagskriminaliteten er selvsagt plagsom, men den truer ikke velferdsstaten p&aring; samme m&aring;te som &oslash;konomisk kriminalitet kan gj&oslash;re. Den kan ha et slikt omfang at den truer samfunnets funksjonsevne, sier Styrvold til Bergens Tidende. (...)</p>
          <p><a href="http://n24.no/naeringsliv/article1424513.ece">Stadig mer vaskes hvitt</a><br />
  n24.no 16.8.2006<br />
  Kampen mot hvitvaskere er blitt t&oslash;ffere. Uten at det har f&oslash;rt til at mindre penger blir vasket rene. (...) </p>
          <p>Vi ser at man i stadig st&oslash;rre grad frakter pengene ut av Norge, i kontanter, og setter dem inn i land som ikke er s&aring; ivrige p&aring; &aring; stille sp&oslash;rsm&aring;l om hvor pengene kommer fra, sier Helge Kvamme i PricewaterhouseCoopers. (...) </p>
          <p><a href="http://n24.no/boers-og-finans/article1423170.ece">Venter p&aring; &Oslash;kokrim</a><br />
  n24.no 16.8.2006<br />
  Bankene har f&aring;tt p&aring; plass sine antihvitvaskingssystemer. Men ikke &Oslash;kokrim. (...)</p>
          <p><a href="http://n24.no/boers-og-finans/article1423169.ece">Kniper flere tusen pengevaskere</a><br />
  n24.no 16.8.2006<br />
  Norske banker har avsl&oslash;rt langt flere fors&oslash;k p&aring; hvitvasking, etter at elektronisk overv&aring;kning ble tatt i bruk for halvannet &aring;r siden. Over 2500 saker er oversendt &Oslash;kokrim. (...)</p>
          <h3>- Er menneskerettigheter i ferd med &aring; bli veldedighet?</h3>
          <p><a href="http://www.hegnar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne mangler rettssikkerhet</a><br />
cannot generate system identifier for general entity "cat"
Line: 4579, Col: 73
…egnar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakern…
reference not terminated by REFC delimiter
Line: 4579, Col: 76
…ar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne m…
reference to external entity in attribute value
Line: 4579, Col: 76
…ar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne m…
general entity "cat" not defined and no default entity
Line: 4579, Col: 73
…egnar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakern…
reference to entity "cat" for which no system identifier could be generated
Line: 4579, Col: 76
…ar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne m…
          hegnar.no 31.7.2007 <br />
          Sosialhjelpsmottakerne har den klart d&aring;rligste rettssikkerheten av alle som mottar tjenester fra det offentlige. (...)          </p>
          <h3>- Flere får sosialhjelp. For første gang  siden 2004 var det i fjor over 130.000 personer som mottok sosialhjelp i  kortere eller lengre tid.</h3>
          <p>(<strong>Anm</strong>:   Flere får sosialhjelp. For første gang siden 2004 var det i fjor over 130.000  personer som mottok sosialhjelp i kortere eller lengre tid. 6,2 milliarder  kroner ble utbetalt. Det er første gang det er utbetalt over 6 milliarder  kroner i sosialhjelp i løpet av et år, viser tall fra Statistisk sentralbyrå. I  de aller fleste kommunene ligger stønadssatsen for en enslig mottaker under  6.000 kroner. I Oslo var satsen 6.589 kroner i 2016. I gjennomsnitt fikk  sosialhjelpmottakerne støtte i 5,1 måneder i løpet av 2016. Den største  gruppen, nesten 27.000 personer, fikk hjelp bare i én måned, mens drøyt 13.000  hadde utbetalinger samtlige tolv måneder. Yngre har gjennomgående kortere  stønadsperioder enn eldre. De som får stønad lengst, er par med barn under 18  år. (<a href="http://frifagbevegelse.no/nyheter/flere-far-sosialhjelp-6.158.475721.4cd748c97f?utm_medium=email&amp;utm_campaign=Daglig%20nyhetsbrev%2007072017&amp;utm_content=Daglig%20nyhetsbrev%2007072017+CID_d8b99674bb0b0f850ec628b011e2097b&amp;utm_source=Nyhetsbrev&amp;utm_term=Flere%20fr%20sosialhjelp">frifagbevegelse.no 6.7.2017</a>).)</p>
          <h3>- Statsoverhoder, internasjonale toppledere og en norsk kronprins møter film- og rockestjerner i Davos denne helga. Det eksklusive toppmøtet World Economic Forum samler hvert år verdens rikeste og mektigste for å diskutere globale utfordringer, som det heter i næringslivet. </h3>
<p><a href="http://www.dagbladet.no/nyheter/2006/01/28/456103.html">Valentinerball</a><br />            
            dagbladet.no 28.1.2006<br />
  Statsoverhoder, internasjonale toppledere og en norsk kronprins m&oslash;ter film- og rockestjerner i Davos denne helga. Det eksklusive toppm&oslash;tet World Economic Forum samler hvert &aring;r verdens rikeste og mektigste for &aring; diskutere globale utfordringer, som det heter i n&aelig;ringslivet. </p>
          <p> Den imponerende deltakerlista har gitt forumet status som et uformelt toppm&oslash;te for verdenseliten. P&aring; det offisielle programmet st&aring;r sosiale temaer som fattigdom, Aids og arbeidsledighet, men mellom slagene er det tid for samtaler om helt andre verdier. I noen dager er Davos forvandlet til et sydende nettverksm&oslash;te for all verdens business. </p>
          <p> Forumet er ikke snauere enn at det problematiserer denne koblingen mellom humanit&aelig;r innsats og r&aring; kommersialisme. Er menneskerettigheter i ferd med &aring; bli veldedighet? sp&oslash;r et panel ledet av filmstjernen Angelina Jolie. Kronprinsen holdt foredrag om hvordan han bruker sin kongelige status for &aring; skaffe oppmerksomhet rundt humanit&aelig;re saker, mens FNs visegeneralsekret&aelig;r Jan Egeland sa i et annet panel at den &oslash;kende privatiseringen av n&oslash;dhjelp krevde bedre organisering. Verdenssamfunnet har aldri v&aelig;rt raskere ute med krisehjelp, men svikter n&aring;r det gjelder den mer langsiktige gjenoppbyggingen etter katastrofer. </p>
          <p> World Economic Forum smaker av et storslagent valentinerball for milliard&aelig;rer og kjendiser. Rockestjernen Bono mener likevel m&aring;let helliger middelet. Han lanserte merkevarer til inntekt for Aids-hjelp. Hippitida er over, erkl&aelig;rte han. Det hjelper ikke lenger &aring; holde hverandre i hendene og synge om fred og kj&aelig;rlighet. </p>
          <p> N&aring;r verdens rikeste rekker ut ei h&aring;nd til verdens fattigste, er det neppe av ren veldedighet, og n&aring;r verdens politiske ledere tar imot den utstrakte h&aring;nda, gj&oslash;r de ogs&aring; det med en grad av kynisme og egeninteresse. Privat veldedighet kan uansett aldri erstatte ansvaret politiske lederskap har for &aring; sikre menneskerettigheter og skape mer global balanse mellom Davos og den fattige delen av verden. (...) </p>
          <p>(<strong>Anm</strong>:  <em>veldedighet</em> kan som oftest <em>kun</em> lindre plager til noen f&aring; utvalgte mennesker (og de som gir?) i en begrenset tidsperide, mens bidrag til &oslash;kt <a href="sprak_sprakforstaelse_og_utdanning.php">utdanning</a> og <a href="http://www.mintankesmie.no/advokater.php">rettssikkerhet</a> (som bl.a. g&aring;r p&aring; bekjempelse av korrupsjon) mulig kan gi varige positive systemendringer.)</p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/etikk_butikk_politikk_veldedighet_og_interessekonflikter.php">Etikk, butikk, gr&aring;dighet, politikk, veldedighet og interessekonflikter (mintankesmie.no).</a>)</p>
          <h3>- Verdens rikeste 1 % får 82 % av rikdommen /velstanden,  sier Oxfam.</h3>
          <p>(<strong>Anm</strong>: Verdens  rikeste 1 % får 82 % av rikdommen /velstanden, sier Oxfam. Gapet mellom de  superrike og resten av verden ble utvidet i fjor, idet rikdommen /velstanden  fortsetter å eies av en liten minoritet, ifølge Oxfam. (…) Det skyldes  skatteunndragelser, firmaers innflytelse på politikken / lovverket, uthuling av  arbeidstakerrettigheter og kostnadsbesparelser for utvidelse av gapet. (…) Uakseptabelt.  (<a href="http://www.mintankesmie.no/fattigdom_fordelingspolitikk_og_rikdom.php#1prosent_82prosent">bbc.com  22.1.2018</a>).)          </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.vg.no/nyheter/utenriks/solberg-regjeringen/erna-paa-eksklusiv-liste/a/23380101/">Sliter  på meningsmålingen, men i Davos er hun pop - Erna på eksklusiv liste - ** 2500  deltar - Erna på toppliste med Gates, Bocelli, Bono og Google-sjefen (vg.no 25.1.2015)</a>.)</p>
          <h3>- Eliten på glattisen i Davos. Verdenseliten elsker sin møteplass i de sveitsiske alper. Men avgrunnen ned til vanlige folks liv ser ut til å bli større. </h3>
          <p>(<strong>Anm</strong>: Eliten på glattisen i Davos. Verdenseliten elsker sin møteplass i de sveitsiske alper. Men avgrunnen ned til vanlige folks liv ser ut til å bli større. Vestlige ledere greier ikke lenger å levere fremtidstro.Hva skjer hvis forskjellene mellom folk øker og tilliten til staten og hele systemet faller? (<a href="https://www.aftenposten.no/meninger/kommentar/i/4dPJG/Eliten-pa-glattisen-i-Davos">aftenposten.no 23.1.2014</a>).)          </p>
          <p>(<strong>Anm</strong>: Trump til  Davos: Trump til Europa for å møte milliardær­vennene sine: - Blir ikke veldig  populær. Alt tyder på at Trump kommer til riking-festen i Davos. Men er det  egentlig noen som vil ha ham der? (<a href="https://www.dagbladet.no/nyheter/trump-til-europa-for-a-mote-milliardaervennene-sine---blir-ikke-veldig-populaer/69367520#_ga=2.167660414.1704228334.1516658286-1826478679.1516654617">dagbladet.no  23.1.2018</a>).)</p>
          <h3> <a name="definisjon_av_dekonstruksjon" id="definisjon_av_dekonstruksjon"></a>- Definisjon av dekonstruksjon</h3>
          <p><a href="https://www.retriever.no/">Derrida, Fl&oslash;gstad og Giske</a><br />
  Ingunn &Oslash;kland, kommentator <br />
  Aftenposten 22.3.2006 <br />
  ENGASJEMENT. Hvis kunstneren har et kall, er det ikke &aring; v&aelig;re st&oslash;ttespiller for velmenende politikere.</p>
          <p>(...) Dekonstruksjon. Den franske filosofen Jacques Derrida er verdensber&oslash;mt for begrepet dekonstruksjon, som han utviklet p&aring; slutten av 1960-tallet. Det er et utvalg fra de tidlige, banebrytende skriftene som i dag presenteres p&aring; norsk for f&oslash;rste gang. Her legger han det filosofiske grunnlaget for en ny skriftforst&aring;else og en ny kunstteori.</p>
          <p>Dekonstruksjon brukes i dag som et fullstendig utflytende og uforpliktende begrep.</p>
          <p> Men i startfasen ble dekonstruksjon utviklet som en fremgangsm&aring;te for &aring; kritisere vestlig metafysikk fra Platon til Martin Heidegger. Ved &aring; plukke fra hverandre hegemoniske begreper &ndash; som sannhet, n&aelig;rv&aelig;r og substans &ndash; s&oslash;ker den unge Derrida &aring; vise hvordan filosofiske og litter&aelig;re tekster ofte rommer selvmotsigelser, tvetydighet og blinde flekker. Begreper vi trodde var klare og rene, kan ved n&aelig;rmere ettersyn vise seg &aring; bygge p&aring; gamle myter om verdens beskaffenhet. (...) </p>
          <p><a href="http://www.aschehoug.no/om/Tidsskrift/article.jhtml?articleID=23446">Agora nr 1-2, 2005 - Derrida</a> (H. Aschehoug &amp; Co (W.Nygaard))<br />
            Intervju med Derrida (jf. s. 12-42).<br />
            <a href="http://www.aschehoug.no/multimedia/archive/00030/Intervju_med_Derrida_30186a.pdf">&laquo;Den andre er skjult fordi han 
            er annerledes&raquo;</a><br />
        Antoine Spire &amp; Jacques Derrida</p>
          <p>I nevnte intervju heter det bl.a., sitat:</p>
          <p>A.S. &ndash; <em>N&aring;r man snakker om Dem, er det to ord som melder seg: Alger, der De<br />
  ble f&oslash;dt, og &ndash; n&aring;r det gjelder Deres verk &ndash; dekonstruksjonen og dens filosofi. De<br />
  definerer dekonstruksjonen ved &aring; si at den dreier seg om &aring; unders&oslash;ke en filosofisk<br />
  tenknings forutsetninger, m&aring;lsetninger og virkem&aring;ter. Men De erkl&aelig;rer<br />
  ogs&aring; at De p&aring; samme tid &oslash;nsker &aring; overliste forventningene, bruke list overfor<br />
  programmene og institusjonene, og avsl&oslash;re det som ligger til grunn for dem, det<br />
  som forutbestemmer dem. Er &aring; dekonstruere i virkeligheten &aring; filosofere?</em></p>
          <p>            J.D. &ndash; Der kan De se, i dette intervjuet gjentar De meg, De minner meg om aff&aelig;ren 
            med de definisjonene (visse av dem, ikke alle) som jeg har tatt sjansen p&aring; &aring; 
            gi av dekonstruksjonen. For ikke &aring; begynne p&aring; nytt, for &aring; henvise til b&oslash;kene 
        samtidig som jeg fremsetter noe som er litt nytt, vil jeg i dag presisere to ting:</p>
          <p>            1. I Frankrike og i utlandet har &laquo;dekonstruksjonen&raquo; en historie som g&aring;r mer<br />
            enn tretti &aring;r tilbake i tid. Denne tilbakelagte vei &ndash; jeg sier ikke denne metoden<br />
&ndash; har transformert, forskj&oslash;vet og komplisert dens definisjon, samt strategiene<br />
og skrivem&aring;tene som selv varierer fra land til land, fra individ til individ, fra en<br />
tekst til en annen. Dette er en differensiering som er vesentlig ved dekonstruksjonen, 
som verken er en filosofi eller en vitenskap, ei heller en metode eller en 
doktrine, men &ndash; slik jeg ofte sier det &ndash; <em>det umulige</em> og det umulige som det som 
<em>skjer</em>.</p>
          <p>I nevnte utgave   (<a href="http://www.aschehoug.no/om/Tidsskrift/article.jhtml?articleID=23446">Agora nr 1-2, 2005 - Derrida</a>, s. 10-11), skriver Derrida i &quot;Brev til en japansk venn&quot;,   bl.a. ogs&aring;, sitat:</p>
          <p>I likhet med ethvert annet ord f&aring;r ordet &laquo;dekonstruksjon&raquo; sin verdi utelukkende fra sin innskrivning i en kjede av mulige substitusjoner, i det man s&aring; ubekymret kaller en &laquo;kontekst&raquo;. For meg, for det som jeg har fors&oslash;kt eller stadig fors&oslash;ker &aring; skrive, har ordet bare interesse innenfor en bestemt kontekst der det erstatter og lar seg bestemme av s&aring; mange andre ord, for eksempel &laquo;skrift&raquo;, &laquo;spor&raquo;, &laquo;differans&raquo;, &laquo;supplement&raquo;, &laquo;hymen&raquo;, &laquo;pharmakon&raquo;, &laquo;rand&raquo;, &laquo;innsnitt&raquo;,<sup>3</sup> &laquo;parergon&raquo;, osv. Listen kan per definisjon ikke bli avsluttet, og jeg har bare anf&oslash;rt navn - noe som er utilstrekkelig og utelukkende &oslash;konomisk. Det ville faktisk 
          ha v&aelig;rt n&oslash;dvendig &aring; anf&oslash;re setninger og sammenkjedninger av setninger som i sin tur, i visse av mine tekster, bestemmer disse navnene.</p>
          <p><a name="alt_selvfolgelig" id="alt_selvfolgelig"></a>Hva dekonstruksjonen ikke er? Alt, selvf&oslash;lgelig! <br />
            Hva dekonstruksjonen er? Ingenting!</p>
          <p>Av alle disse grunnene tror jeg ikke at det er et <em>godt ord</em>.<sup>4</sup> Fremfor alt er det ikke vakkert. I en h&oslash;yst bestemt situasjon har det ganske visst v&aelig;rt nyttig. For &aring; vite hva som har fremtvunget det innenfor en kjede av mulige substitusjoner, trass i dets essensielle ufullkommenhet, ville det v&aelig;re n&oslash;dvendig &aring; analysere og dekonstruere denne &laquo;h&oslash;yst bestemte situasjon&raquo;. Dette er vanskelig og jeg skal ikke gj&oslash;re det her.</p>
          <p>Ett ord til for &aring; fremskynde konklusjonen, siden dette brevet allerede er for langt. Jeg tror ikke oversettelsen er en sekund&aelig;r og avledet begivenhet i forhold til et opprinnelig spr&aring;k eller en opprinnelig tekst. Og &laquo;dekonstruksjonen&raquo;, som jeg nettopp har sagt, er et ord som essensielt lar seg erstatte innenfor en kjede av substitusjoner. Dette lar seg ogs&aring; gj&oslash;re fra ett spr&aring;k til et annet. Dekonstruk-sjonens sjanse og mulighet, det ville v&aelig;re at et annet ord (det samme og et annet) <em>finnes</em> eller <em>blir oppfunnet</em> p&aring; japansk, for &aring; uttrykke det samme forhold (det samme og noe annet), for &aring; tale om dekonstruksjonen og for &aring; <em>bringe den annetsteds</em>, skrive den og <em>transkribere</em> den med et ord som ogs&aring; ville v&aelig;re vakrere. N&aring;r jeg taler om denne den andres/det andres skrift som ville v&aelig;re vakrere, forst&aring;r jeg naturligvis oversettelsen som diktets risiko og sjanse. Hvordan oversette &laquo;dikt&raquo;, et &laquo;dikt&raquo;? (...)</p>
        <p><sup>3</sup>  Fors&oslash;k p&aring; &aring; oversette &laquo;entame&raquo;, som egentlig betyr det f&oslash;rste stykket som blir sk&aring;ret av noe (spiselig). (Termen er for &oslash;vrig Derridas oversettelse av Heideggers begrep 
          &laquo;Aufriss&raquo;.) (O.a.)<br />
        <sup>4</sup>  Fransk &laquo;bon mot&raquo; betyr ogs&aring; sp&oslash;k, vits. (O.a.)</p>
        <p><b>(</b><strong>Anm</strong><b>: </b><em>transkribere</em> <i>(tran|skribe&acute;re)</i> v2 (fra lat., av <i>trans-</i> og <i>scribere</i> 'skrive') omskrive, overf&oslash;re, f eks tekst fra ett alfabet til et annet el. musikk fra ett instrument til et annet. <strong>Kilde</strong>: <a href="http://www.ordnett.no/ordbok.html">ordnett.no</a>.)</p>
        <h3>- De f&aring; utvalgte</h3>
        <p><a href="http://www.nrk.no/programoversikt/avansert/?p_artikkel_id=&amp;p_forhandsvis_flg=0&amp;p_format=HTML&amp;p_type=prog&amp;p_fom_dag=19&amp;p_fom_mnd=4&amp;p_fom_ar=2006&amp;p_periode=dennedagen&amp;p_nrk1=NRK1&amp;p_soketekst=&amp;p_knapp=Vis+nedenfor">De f&aring; utvalgte</a><br />
  nrk.no 19.4.2006<br />
  Svensk dokumentar. P&aring; toppene finner vi jobber som det ikke g&aring;r an &aring; s&oslash;ke p&aring;. Mer enn fem hundre generaldirekt&oslash;rer, dommere og ambassad&oslash;rer utpekes direkte av den svenske regjeringen. P&aring; hvilket grunnlag? Vi begir oss inn i en lukket prosess og ser hvordan spillet foreg&aring;r bak kulissene i maktens korridorer. - Og hvordan foreg&aring;r dette i Norge? (...) </p>
        <p><a href="http://svt.se/svt/jsp/Crosslink.jsp?d=26971&amp;a=487573&amp;lid=puff_497993&amp;lpos=lasMer">De utvalda</a><br />
  Dokument inifr&aring;n svt.se (2005/2006)<br />
  De f&aring;r jobben som inte g&aring;r att s&ouml;ka. &Ouml;ver 500 generaldirekt&ouml;rer, domare och ambassad&ouml;rer utses direkt av regeringen. Men p&aring; vilka grunder? P&auml;r Fj&auml;llstr&ouml;m granskar utn&auml;mningspolitiken, en process st&auml;ngd f&ouml;r all insyn. Nu ber&auml;ttar en h&ouml;g departementstj&auml;nsteman som varit med om m&aring;nga utn&auml;mningar hur spelet g&aring;r till vid de omtvistade utn&auml;mningarna.</p>
        <p> St&auml;ngt f&ouml;r insyn. G&ouml;ran Persson utser mer &auml;n 500 statliga chefer - men p&aring; vilka grunder? Collage: SVT GrafikGeneraldirekt&ouml;rer, landsh&ouml;vdingar, domare och ambassad&ouml;rer utses direkt av regeringen. Och grundlagen &auml;r mycket tydlig kring hur det ska g&aring; till: &quot;Vid tills&auml;ttning av statlig tj&auml;nst skall avseende f&auml;stas endast vid sakliga grunder, s&aring;som f&ouml;rtj&auml;nst och skicklighet&quot;. Desto sv&aring;rare &auml;r det att granska om grundlagen verkligen f&ouml;ljs. </p>
        <p><strong>Klicka h&auml;r f&ouml;r st&ouml;rre bild</strong><br />
  I Dokument inifr&aring;n: De utvalda kartl&auml;gger P&auml;r Fj&auml;llstr&ouml;m den svenska utn&auml;mningspolitiken. Att det till stor del handlar om bel&ouml;ningar och politiska h&auml;nsynstaganden bekr&auml;ftar SVT.s k&auml;lla: </p>
        <p>- Vi fick lite pluspo&auml;ng om vi nominerade personer med moderat bakgrund - det ans&aring;gs sv&aring;rt hitta dugliga moderater till generaldirekt&ouml;rsbefattningar, s&auml;ger han. </p>
        <p>I m&aring;nga andra l&auml;nder &auml;r politiska utn&auml;mningar bannlysta. I Norge annonseras alla h&ouml;ga tj&auml;nster, ans&ouml;kningarna &auml;r offentliga och politiker har ingen gr&auml;ddfil. I Storbritannien &ouml;vervakas tills&auml;ttningarna noggrant av en frist&aring;ende kommission. I Sverige v&auml;xer nu kritiken.</p>
        <p>- Det &auml;r ett arv fr&aring;n adelsmannatiden, s&auml;ger f&ouml;rre finansministern Kjell-Olof Feldt. </p>
        <p>Och Inga-Britt Ahlenius, tidigare chef f&ouml;r Riksrevisionsverket, skr&auml;der inte orden: </p>
        <p>- Jag menar att Sverige bryter mot FN:s resolution mot korruption, som kr&auml;ver att statstj&auml;nstem&auml;n ska tills&auml;ttas &ouml;ppet och p&aring; meriter. Men i Sverige har vi ju ingen aning om p&aring; vilka grunder generaldirekt&ouml;rer utn&auml;mns. </p>
        <p><strong>Program p&aring; webben </strong><br />
  Programmen i serien Sju partier kommer att finnas tillg&auml;ngliga p&aring; webben efter s&auml;ndning.</p>
        <p>Se partiprogrammen<br />
          Se tidigare dokument inifrån (...)</p>
        <h3><a name="samrore_hattebytte_sakkyndighet" id="samrore_hattebytte_sakkyndighet"></a>- Sakkyndiges dobbeltroller </h3>
        <p><a href="http://www.morgenbladet.no/apps/pbcs.dll/article?AID=/20060120/ODEBATT/101200006/-1/DEBATT">Samr&oslash;re hattebytte &ndash; rettssikkerhet?</a><br />
  Jan Hansen - Frilansjournalist (NJ) <br />
  morgenbladet.no 20.1.2006<br />
  Sverre Kvilhaugs innlegg i Morgenbladet forrige uke var veldig interessant lesing. Innsenderen reiser her flere viktige sp&oslash;rsm&aring;l omkring de sakkyndiges dobbeltroller som har f&aring;tt negative konsekvenser for sv&aelig;rt manges rettssikkerhet. Advokat Kvilhaug tar i sitt innlegg ogs&aring; i bruk ord som samr&oslash;re og hattebytte. Men! Og det er et stort Men! Det kan samtidig stilles sp&oslash;rsm&aring;l omkring enkelte advokater og dommeres samr&oslash;re og hattebytte osv. Og nettopp i forbindelse med rettssikkerheten. For er det egentlig etisk forsvarlig av en advokat eller en dommer &aring; operere p&aring; flere sider samtidig, spesielt dersom birollen medf&oslash;rer delaktighet i avgj&oslash;relser p&aring; den politiske arena? (...)</p>
        <p>(<strong>Anm</strong>:  <a href="http://mintankesmie.no/sakkyndige_legers_integritet_partiskhet_og_habilitet.php">Sakkyndige legers integritet, partiskhet og habilitet versus løgn i rettssalen (sakkyndighet)</a>.)</p>
        <h3>- &quot;Svingd&oslash;ren&quot; som gir n&aelig;ringslivsinteresser utilb&oslash;rlig innflytelse p&aring; statlig politikk og medvirkning i beslutninger</h3>
        <p>De store advokatfirmaer, som mottar kjempehonorarer fra n&aelig;ringslivet (uten at man riktig vet hvorfor?), ut&oslash;ver imidlertid sitt virke p&aring; en slik m&aring;te at de ogs&aring; har stor innflytelse p&aring; statlig politikk og viktige beslutningsprosesser.</p>
        <p>Forklaringen p&aring; at honorarene til de store advokatfirmaer er skyh&oslash;ye, skyldes bl.a. at de skal dekke utgifter til &aring; &quot;sm&oslash;re&quot; den <a href="http://www.mintankesmie.no/lobbyisme.php">svingd&oslash;ren</a> som gir n&aelig;ringslivsinteresser innflytelse p&aring; statlig politikk, ikke minst i saker som g&aring;r p&aring; lovgivning og rettssikkerhet.</p>
        <p>Problemet er imidlertid at det rettssikkerhetsgapet som oppst&aring;r grunnet utilb&oslash;rlig lobbyvirksomhet, som enkelte n&aelig;ringslivsinteresser bokstavelig talt lever fett av, oppmuntrer til <a href="interessekonflikter_bestikkelser_og_korrupsjon.php">interessekonflikter og korrupsjon</a>, med &oslash;kt <a href="http://www.mintankesmie.no/legemiddelutprovning_legemiddelkontroll_og_legemiddelkriminalitet.php">kriminalitet</a> og <a href="fattigdom_fordelingspolitikk_og_rikdom.php">fattigdom</a> som resultat. </p>
        <p>En rettferdig rettergang, som egentlig burde v&aelig;re en grunnleggende verdi for alle mennesker, slik enkelte akt&oslash;rer antyder i sine festtaler, er derfor i praksis forbeholdt rike, kriminelle, og privat og offentlig virksomhet. (...)</p>
        <h3>- Vern om &quot;fri rettshjelp&quot;?</h3>
        <p><a href="https://www.retriever.no/">Vern om fri rettshjelp</a><br />
  Leder <br />
  aftenposten.no 21.4.2006 <br />
  <strong>STATEN TAR</strong> med den ene h&aring;nden, gir med den andre og slipper billigere unna. I praksis &oslash;ker st&oslash;tten til <a href="http://www.bymisjon.no/templates/Page____14541.aspx">Gatejuristen</a> i Oslo, mens bevilgningene til fri rettshjelp reduseres. Vi er enig med byr&aring;d Torger &Oslash;degaard n&aring;r han sier at dette er dramatisk. Det er positivt ag Gatejuristen f&aring;r mer penger, men dette burde v&aelig;rt friske penger. Bevilgningen blir imidlertid finansiert ved hjelp av en halvering av bevilgningene til <a href="http://www.storby.oslo.kommune.no/fri_rettshjelp/">kontoret for fri rettshjelp</a> i l&oslash;pet av to &aring;r. (...)</p>
        <p><strong>VI ER ENIG</strong> med professor Kristian Anden&aelig;s n&aring;r han skriver at &quot;det blir noks&aring; trist n&aring;r justisminister knut Storberget som noe av det f&oslash;rste han gj&oslash;r med denne urimeligheten, er &aring; gj&oslash;re den enda st&oslash;rre.&quot; (...) </p>
        <h3><a name="grunnloven_ma_styrkes" id="grunnloven_ma_styrkes"></a>- Grunnloven m&aring; styrkes</h3>
        <p><a href="http://www.aftenposten.no/meninger/kronikker/article1288491.ece">Grunnloven m&aring; styrkes</a><br />
  CARSTEN SMITH <br />
  aftenposten.no 22.4.2006<br />
  <strong>DEBATTEN OM GRUNNLOVEN. </strong>B&aring;de menneskerettighetene og Grunnloven b&oslash;r styrkes ved &aring; innskrive flere rettigheter i Grunnloven. Dette gjelder rettsstatens vern av det enkelte mennesket - og av mindretall i befolkningen. </p>
        <p>FORAN NORSKE LOVER. Menneskerettsloven kom i 1999. Den gjorde den europeiske menneskerettskonvensjon av 1950 til norsk lov, sammen med de to FN konvensjoner av 1966 om sivile og politiske rettigheter og om &oslash;konomiske, sosiale og kulturelle rettigheter. </p>
        <p> Loven ga samtidig disse konvensjonene en forrang fremfor annen norsk lovgivning. Senere har ogs&aring; barnekonvensjonen av 1989 f&aring;tt sin plass her. H&oslash;yesterett har fulgt opp reformen og gjort aktiv bruk av loven i det nye &aring;rhundret. </p>
        <p> Men det siste skritt mangler: Innskrivningen i selve Grunnloven. Det vil markere at Norge ikke bare er en rettsstat, men ogs&aring; en menneskerettsstat. (...)</p>
        <p><strong>Nasjonens verdigrunnlag.</strong><br />
  Grunnlovfesting dreier seg ikke bare om statsmakter og rettskrav. Grunnloven viser v&aring;rt verdigrunnlag. Den fastsl&aring;r en &quot;samfunnskontrakt&quot; - en felles forst&aring;else av samfunnets hovedtrekk - som folket til enhver tid har med myndighetene. </p>
        <p> En plass i Grunnloven vil medf&oslash;re en positiv p&aring;virkning. Det vil trolig styrke rettighetene - og Grunnloven selv - i skolenes undervisning og i folkeopinionen. Og det vil fremvise v&aring;rt samfunn p&aring; en riktig m&aring;te i internasjonalt arbeid. (...)</p>
        <p> Menneskerettighetene er et forsvarsverk mot handlinger fra offentlige myndigheter. Det er derfor avgj&oslash;rende med kontroll av uavhengige domstoler. En styrking av rettighetene inneb&aelig;rer en st&oslash;rre myndighet til domstolene. Selv ser jeg dette som en styrking av rettsstaten. Andre vil v&aelig;re mer negative. Men vil man menneskerettigheter, m&aring; man ogs&aring; ville en styrking av domstolene. (...) </p>
        <h3><a name="straffesaker_og_rettssikkerhet" id="straffesaker_og_rettssikkerhet"></a>- Straffesaker og rettssikkerhet </h3>
        <p><a name="ma_lare_bevisvurdering" id="ma_lare_bevisvurdering"></a><a href="http://www.vg.no/nyheter/innenriks/artikkel.php?artid=516344">Mener jurister og politifolk m&aring; l&aelig;re bevisvurdering</a><br />
  vg.no 9.6.2008<br />
  Bevisvurdering m&aring; gj&oslash;res til en sentral del i utdanningen og etterutdanningen av jurister, politifolk og sakkyndige, skriver professorene Anders Bratholm og St&aring;le Eskeland i en ny bok, &laquo;Justismord og rettssikkerhet&raquo;. </p>
        <p> If&oslash;lge Bratholm og Eskeland gis det i dag nesten ingen undervisning i bevisvurdering, verken p&aring; Politih&oslash;gskolen eller ved universitetene. De to jussprofessorene tror at &laquo;faglig basert undervisning i bevisvurdering&raquo; p&aring; lengre sikt kan bidra til &aring; redusere antallet justismord og &aring; f&aring; gale dommer omgjort. (...)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.vg.no/nyheter/innenriks/tina-saken/tina-saken-har-kastet-haarbeviser/a/23598620/">Tina-saken:  Har kastet hårbeviser. ** Advokat: - Det er noe molboaktig over dette. (…) I  etterkant av at saken ble henlagt i 2003, har hårstråene blitt destruert i  henhold til gjeldende rutiner. Hårstråene er ikke lenger i politiets beslag,  står det i brevet. (…) TV2 omtalte i fjor høst en hemmelig rapport som beskrev  rettssikkerhetsproblemet ved at det i dag ikke finnes noe klart regelverk for  oppbevaring av beviser i straffesaker. (…) Et eksempel på saker der bevis er  kastet er Orderud-saken, som nå blir forsøkt gjenopptatt. Og i et av Norges  mest kjente justismord, Fritz Moen-saken, ble en koffert med bevis funnet på  museum, skrev TV2 i fjor høst. (vg.no 21.1.2016)</a>.) </p>
        <p>(<strong>Anm</strong>:  Tilståelsen.  Hjem Ep. 1: Tilståelsen Ep. 2: Drapene som rystet Norge Publiseres langfredag  Les nå med Pluss → Ep. 3: Oppskriften på et justismord Publiseres 23. april Ep.  4:… (<a href="http://www.dagbladet.no/magasinet/tilstaelsen/67393965#_ga=1.269290357.568143359.1491752394">dagbladet.no  9.4.2017</a>).)</p>
<p><a href="http://www.dagbladet.no/nyheter/2006/03/12/460447.html">Dom og bevismord</a><br />
          Leder
          <br />
        dagbladet.no 12.3.2006<br /> 
        F&oslash;rste runde i NOKAS-saken er over, og den er allerede sikret en plass i rettshistorien. Den viktigste &aring;rsaken er at saken framst&aring;r med klare fronter mellom statens autoritet og det kriminelle fellesskapet. Dette ble da ogs&aring; vektlagt i den dom som fredag falt i tingretten i Stavanger. Samtidig er NOKAS den dyreste saken i nyere tid. De offentlige kostnadene har kommet opp i 300 mill. kroner og vi er enn&aring; langt fra sluttregningen. NOKAS er ogs&aring; historiens mest omtalte straffesak. Det er registrert mer enn 40 000 artikler p&aring; papir og p&aring; nett. </p>
        <p> <a name="til_dem_som_er_bekymret" id="til_dem_som_er_bekymret"></a>Til dem som er bekymret for kostnadsniv&aring;et er det bare en ting &aring; si: Ja, kriminalitet er dyrt for samfunnet. Hvis vi ikke bekjemper den, blir det bare mer l&oslash;nnsomt for forbryterne. Det betyr ikke at alle tiltak i NOKAS-saken har v&aelig;rt like godt gjennomtenkt. Det kostbare sikkerhetsopplegget har f. eks. hatt karakter av propaganda for statsmakten. Likevel er det viktig &aring; holde fast ved at vi m&aring; v&aelig;re villige til &aring; betale rettsstatens pris. <strong>En rettferdig rettergang er ikke et frynsegode for kriminelle, men en grunnleggende verdi for alle mennesker. </strong></p>
        <p> Derfor er det helt andre sider enn prislappen vi b&oslash;r interessere oss for n&aring;r NOKAS-saken ruller videre. Tingrettens dom var et knusende nederlag for de tiltalte og deres forsvarere, og den vil bli angrepet med alle midler. Det er ogs&aring; n&oslash;dvendig. Ikke fordi tingretten ved sin dom har beg&aring;tt justismord. Deler av dommen tyder likevel p&aring; at det kan ha skjedd et bevismord, dvs. at retten har foretatt meget bastante vurderinger av sentrale saksforhold, vitneprov og framlagte bevis. Slik er NOKAS et godt eksempel p&aring; behovet for ankeadgang i store straffesaker.</p>
        <p> Det er ogs&aring; behov for &aring; f&aring; en ny vurdering av straffenes lengde og bruken av forvaring. Forvaring inneb&aelig;rer at straffen kan bli uten begrensing i tid, noe som er et meget sterkt inngrep i menneskers liv og integritet. Tingretten har i NOKAS-saken lagt til grunn en tolkning av vilk&aring;rene for forvaring som er meget streng. P&aring; dette punkt er det helt n&oslash;dvendig at siste ord blir sagt av h&oslash;yesterett. (...)</p>
        <h3>- Marsipanp&oslash;lse-saken</h3>
        <p><a href="http://www.dagbladet.no/nyheter/2006/06/21/469555.html">Marsipanp&oslash;lsa er borte</a><br />
          dagbladet.no 21.6.2006<br />
          LEI AV P&Oslash;LSESNAKK: Kjendisadvokat Christian Wiig setter sp&oslash;rsm&aring;lstegn ved politiets ressursbruk.<br />
        (...) <strong>Uenig i ressursbruk</strong><br />
        Marsipanrettssaken p&aring;gikk i fire timer i dag. F&oslash;r den tid har politiet brukt ressurser for &aring; etterforske hva som skjedde p&aring; Narvesen-kiosken i november i fjor. </p>
        <p>- F&oslash;rst vil jeg si at politiet har rett til &aring; ta en slik sak til rettsalen. Det skal ikke v&aelig;re lov &aring; naske og slippe unna med det. Men jeg setter sp&oslash;rsm&aring;lstegn ved politiets prioritering av tid og ressurser, sier Wiig til Dagbladet.no (...)</p>
        <p><strong>Prinsippsak</strong><br />
        Det p&aring;st&aring;tte marsipantyveriet skal ha skjedd i november i fjor, da en 26-&aring;ring var p&aring; bytur etter et julebord. Der ble mannen holdt igjen utenfor en Narvesenbutikk av en av de ansatte.</p>
        <p> - Han sa at jeg hadde stj&aring;let ei marsipanp&oslash;lse og begynte &aring; ransake meg. Da han ikke fant noe, p&aring;sto han at jeg hadde spist den inne p&aring; Narvesen, sa tiltalte til Adresseavisen.</p>
        <p> 26-&aring;ringen nektet for &aring; ha stj&aring;let p&oslash;lsa og hevdet at det hele var en misforst&aring;else. Men etter &aring; ha gitt personlia til politiet, fikk han et forelegg p&aring; 3000 kroner i posten. Mannen p&aring;klaget forelegget fordi han fryktet at han ville bli nektet innreise til USA hvis anklagene mot ham blir st&aring;ende. </p>
        <p> Dermed ble marsipansaken til rettssaken, som n&aring; p&aring;g&aring;r i Trondheim tingrett. Den s&aring;kalte marsipansaken har if&oslash;lge Adresseavisen vakt oppsikt ogs&aring; utenfor landegrensene. Flere setter sp&oslash;rsm&aring;lstegn ved bruken av ressurser opp mot gjenstanden som ble stj&aring;let. </p>
        <p> Saken blir n&aring; brukt som en prinsippsak. B&aring;de forsvarer og aktor understreker viktigheten ved &aring; ta opp prinsipielle saker slik at publikum ikke kan nekte &aring; godta forelegg og s&aring; g&aring; fri. (...)</p>
        <h3>- Kakekaster-saken</h3>
        <p><a href="http://www.aftenposten.no/nyheter/iriks/article2110121.ece">Kakekaster slipper straff</a><br />
          aftenposten.no 19.11.2007 <br />
        Riksadvokaten mener at bl&oslash;tkakekaster John Waagaard har hindret en statsr&aring;d i sitt arbeid. Men han f&aring;r p&aring;taleunnlatelse i stedet for straff. (...)</p>
        <p>P&aring;taleunnlatelse er en konstatering av straffskyld, og John Waagaard kan derfor kreve at p&aring;talemyndigheten bringer saken inn for retten dersom han ikke godtar avgj&oslash;relsen. (...) </p>
        <p>&ndash; Jeg m&aring; nesten h&oslash;re med advokaten min, han er p&aring; ferie n&aring;, sier Waagaard. <br />
          Han vil ikke ta stilling til om han vil pr&oslash;ve &aring; f&aring; saken gjenopptatt. (...)        </p>
        <p><a href="http://www.vg.no/pub/vgart.hbs?artid=183751">H&oslash;yesterett opphevet dom mot kakekaster</a><br /> vg.no 8.11.2007 <br />
  (VG Nett) H&oslash;yesterett har opphevet dommen mot John Waagaard som ble d&oslash;mt til fengsel for &aring; ha kastet en kake p&aring; finansminister Kristin Halvorsen (SV). (...)        </p>
        <p><a href="http://www.vg.no/pub/vgart.hbs?artid=177214">Kakekast til H&oslash;yesterett</a><br /> vg.no 28.10.2007 <br />
  (...) Mange ble overrasket da p&aring;talemyndigheten valgte &aring; tiltale Waagaard etter den sv&aelig;rt lite brukte paragraf 99 i straffeloven. (...)        </p>
        <p><a href="http://www.nrk.no/nyheter/1.3703519">Kakekaster til H&oslash;yesterett</a><br />
          nrk.no 10.10.2007 <br />
          H&oslash;yesterett skal behandle ankesaken til 25-&aring;ringen som kastet en kake p&aring; finansminister Kristin Halvorsen (SV). (...)        </p>
        <p><a href="http://www.vg.no/pub/vgart.hbs?artid=167998">- Anker kakekastingsdommen til H&oslash;yesterett</a><br />
        vg.no 7.5.2007<br />
        (...) - Jeg har forst&aring;tt at anken ble avvist, og da anker vi til H&oslash;yesterett, sier Waagaards forsvarer, Harald Stabell, til VG Nett mandag. (...)        </p>
        <p><a href="http://www.aftenposten.no/meninger/article1557056.ece">En dom som skurrer</a><br />
          aftenposten.no 5.12.2006<br />
          ANKE. John Waagaard (24) anker dommen p&aring; 30 dagers ubetinget fengsel for &aring; ha kastet kake p&aring; finansministeren. Det er bra. (...)
        </p>
        <p><a href="http://www.nettavisen.no/innenriks/article764683.ece">Kakekaster angrer bittert</a><br />
          nettavisen.no 11.10.2006<br />
          John Waagaard kastet kake i ansiktet p&aring; finansminister Kristin Halvorsen. N&aring; er det tatt ut tiltale mot Waagaard med en strafferamme p&aring; 15 &aring;r. (...)        </p>
        <p><a href="http://www.dagbladet.no/kultur/2006/07/30/472577.html">Kaker og andre streker</a><br />
        Nils-Petter Enstad Forfatter<br />dagbladet.no 30.7.2006<br />
        KARIKATUR: En avis trykker en tegning der en demokratisk valgt statsminister i et land framstilles som en nazikommandant som skyter p&aring; blink for moro skyld p&aring; forsvarsl&oslash;se mennesker. N&aring;r det kommer reaksjoner p&aring; dette, blir avisen pomp&oslash;s, slik aviser som kritiseres har lett for &aring; bli, og begrunner dette med &laquo;ytringsfriheten&raquo;. (...)        </p>
        <p><a href="http://www.nettavisen.no/innenriks/article696123.ece">Kakekaster dypt deprimert</a><br />
          nettavisen.no 29.7.2006<br />
          24-&aring;ringen har slitt hardt etter at han kastet en marsipankake p&aring; finansminister Kristin Halvorsen i fjor. (...)        </p>
        <p><a href="http://www.nrk.no/nyheter/innenriks/1.779582">Kakekaster kan f&aring; 15 &aring;r</a><br />
          nrk.no 28.7.2006<br />
          Studenten som kastet en kake p&aring; finansminister Kristin Halvorsen i fjor, er tiltalt for &aring; ha beg&aring;tt en forbrytelse mot forfatningen. (...)        </p>
        <p><a href="http://www.dn.no/forsiden/politikkSamfunn/article841052.ece">Kakekaster tiltalt</a><br />
          dn.no 28.7.2006<br />
        Alvorlig tiltale mot studenten som kastet kake p&aring; finansminister Kristin Halvorsen (SV) ifjor. (...)</p>
        <p>Slik oppf&oslash;rsel mot norske ministere kan f&aring; alvorlige konsekvenser. <br />
        Studenten er n&aring; tiltalt for &aring; ha beg&aring;tt en forbrytelse mot Norges statsforfatning. </p>
        <p> Angrepet p&aring; Halvorsen skjedde utenfor Finansdepartementet om morgenen 18. oktober i fjor, p&aring; hennes f&oslash;rste arbeidsdag. (...)</p>
        <p><strong>Helt til Riksadvokaten</strong><br />
          Sp&oslash;rsm&aring;let om hvilken straffebestemmelse som skulle brukes mot 24-&aring;ringen har v&aelig;rt helt oppe hos Riksadvokaten. Strafferammen er 15 &aring;rs fengsel. <br />
        &ndash; Vi endte med en relativt alvorlig tiltale, sier f&oslash;rstestatsadvokat Marit Bakkevig i Oslo til <a href="http://www.vg.no/pub/vgart.hbs?artid=124703">VG</a>. (...)</p>
        <p>Halvorsen er innkalt som vitne i saken, som er berammet for Oslo tingrett 11. oktober. </p>
        <p> Mannen som mente at kakekastingen hans var humoristisk og uskyldig, var ikke forberedt p&aring; reaksjonene i ettertid. Etter kakeoverfallet avbr&oslash;t han studiene, og han mistet ogs&aring; jobben. (...) </p>
        <p>(<strong>Anm</strong>:  <a href="http://www.blogging.no/blog.php/oerjanb/post/13639%20">Kommentar: BellBloggen. Farlig kakekasting (30.7.2006)</a>.)</p>
        <p><a href="http://www.dagbladet.no/nyheter/2001/04/27/254488.html">Bringsv&aelig;rd applauderer bl&oslash;tkakejentene</a><br />
          dagbladet.no 27.04.2001<br />
          Den kjente forfatteren Tor &Aring;ge Bringsv&aelig;rd er mannen som f&oslash;rst fant ut at bl&oslash;tkaker kan brukes i aksjoner. Han applauderer jentene som ga Sylvia Brustad &eacute;n i fleisen onsdag. (...)
        </p>
        <h3>- Nokas-saken
</h3>
        <p><a href="http://www.vg.no/pub/vgart.hbs?artid=141088">NOKAS-sal&aelig;r: 80 millioner kroner</a><br /> vg.no 15.6.2007 <br />
        Rettsprosessen etter NOKAS-ranet er tidenes dyreste.</p>
        <p>S&aring; langt har de 13 advokatene og deres assistenter kvittert ut sal&aelig;r og utgifter til kost og losji for 80 millioner kroner. </p>
        <p>I tillegg har staten s&aring; langt betalt 235 millioner kroner til blant annet etterforskning og sikring av rettssalene i tingretten og lagmannsretten, melder NRK. (...)</p>
        <p>(<strong>Anm</strong>:  Nokas-saken, som politikerne  prioriterer  h&oslash;yt for &aring; sikre at de involverte akt&oslash;rer f&aring;r en tilstrekkelig grad av rettssikkerhet, har hittil kostet samfunnet mer enn 300 millioner kroner, dvs. omtrent 25 % av de samlede utgiftene til rettshjelp i  straffesaker og sivile saker i 2005.)</p>
        <h3>- Konflikter skal l&oslash;ses med god rettshjelp </h3>
        <p><a href="http://www.dagbladet.no/nyheter/2006/03/26/461908.html">Regjeringen gir 90 millioner til &aring; stoppe voldtektsb&oslash;lge</a><br />
  dagbladet.no 26.3.2006<br />
  Justisminister Knut Storberget har sett seg lei av politidistriktenes nedprioritering av voldtektssaker. N&aring; bevilger regjeringen 90 millioner kroner til oppf&oslash;lging av ofrene.</p>
        <p> Han mener det ikke skal v&aelig;re voldtektsofrenes ansvar &aring; f&oslash;re sivile s&oslash;ksm&aring;l for at samfunnet skal reagere p&aring; forbrytelsen de har v&aelig;rt utsatt for. Han kjenner ikke saken om den 61-&aring;rige kvinnen, men uttaler p&aring; generelt grunnlag: </p>
        <p> - Dette er en privatisering av rettspleien som jeg slettes ikke synes noe om. Jeg vil ikke fjerne retten til &aring; saks&oslash;ke, men voldtektsofre har nok &aring; stri med om de ikke ogs&aring; skal ta ansvaret for en risikabel sivilprosess, sier Storberget.<br />
  Han peker p&aring; at slike saker ofte ikke f&oslash;rer fram, og at saks&oslash;ker risikerer &aring; m&aring;tte dekke saksomkostninger b&aring;de for seg selv og for motparten. (...) </p>
        <p><a href="http://www.aftenposten.no/meninger/debatt/article1246446.ece">Konflikter skal l&oslash;ses med god rettshjelp</a><br />
  KNUT STORBERGET, justisminister<br />
  aftenposten.no 12.3.2006<br />
  <strong>Rettssikkerhet.</strong> Som justisminister har jeg ansvar for &aring; ivareta at folk f&aring;r n&oslash;dvendig rettshjelp i straffesaker og i sivile saker. Dette inneb&aelig;rer et ansvar for &aring; f&oslash;lge opp og justere regelverket slik at det fungerer best mulig og ivaretar brukernes rettssikkerhet, samtidig som jeg har ansvaret for at skattebetalernes penger forvaltes p&aring; best mulig m&aring;te. </p>
        <p>Rettshjelpen m&aring; m&aring;lrettes mot dem som trenger den mest. I Soria Moria-erkl&aelig;ringen fremg&aring;r det at rettshjelpsordningen skal gjennomg&aring;s og forbedres. Utgiftene til rettshjelp i straffesaker og sivile saker har de siste &aring;rene &oslash;kt drastisk. I 2005 var utgiftene p&aring; totalt 1,27 milliarder (inkl. moms), mens de i 1999 var p&aring; ca. 510 millioner (eks. moms). Det er viktig &aring; ha kontroll p&aring; rettshjelpsutgiftene, og det er viktig at rettshjelpen b&aring;de i sivile saker og i straffesaker kanaliseres dit den trengs mest. Advokatene m&aring; gjerne argumentere for sine synspunkter ut fra hva som ville v&aelig;re det ideelle. Som justisminister m&aring; jeg konsentrere meg om &aring; finne gode l&oslash;sninger som ivaretar flere hensyn. V&aring;re vurderinger av regelverket, og omfanget av ulike typer rettshjelp som tilbys, vil derfor ikke n&oslash;dvendigvis falle likt ut. </p>
        <p>Jeg er opptatt av &aring; bidra til at konflikter l&oslash;ses p&aring; en god m&aring;te. Det inneb&aelig;rer ikke n&oslash;dvendigvis kostnadskrevende runder i rettsapparatet. Det kan v&aelig;re gjennom &aring; kanalisere flere saker til konfliktr&aring;dene eller &aring; bidra med midler til lavterskeltilbudene, som studentrettshjelpstiltakene, tiltak i regi av Gatejuristen, PION (Prostituertes interesseorganisasjon) og ikke minst til fors&oslash;ksordningen med juridisk bistand p&aring; offentlige servicekontorer. (...) </p>
        <p>(<strong>Anm</strong>:  Konlikter b&oslash;r l&oslash;ses ved gratis rettshjelp til alle mennesker via en felles forsikringsordning, ikke tilfeldige tilfeldige bevillinger og enkelte politikeres skiftende visjoner.)</p>
        <h3>- Justitiekanslerns r&auml;ttss&auml;kerhetsprojekt</h3>
        <p> Pressinformation onsdagen den 7 juni om Justitiekanslerns r&auml;ttss&auml;kerhetsprojekt<br />
        jk.se 7.6.2006          -        <a href="http://www.jk.se/aktuellt/Pressinfo060607.doc">L&auml;s mer h&auml;r</a></p>
        <p>(...) R&auml;ttss&auml;kerhetsprojektets rapport </p>
        <p>Projektgruppen har arbetat sj&auml;lvst&auml;ndigt. I rapporten Felaktigt d&ouml;mda redovisas arbetet. Den inneh&aring;ller bl a f&ouml;ljande:</p>
        <ul>
          <li> Vad betyder &rdquo;r&auml;ttss&auml;kerhet&rdquo;? &ndash; Inventering och analys av r&auml;ttss&auml;kerhetsbegreppet</li>
          <li>R&auml;ttss&auml;kerhetsgarantierna i brottm&aring;lsprocessen</li>
          <li>Bortom rimligt tvivel? &ndash; En redog&ouml;relse f&ouml;r beviskravet i brottm&aring;l</li>
          <li>Resningsreglerna enligt svensk lag</li>
          <li>En kartl&auml;ggning av resningsfall fr&aring;n 1950-2005</li>
          <li>N&auml;rmare studium av fall som g&auml;ller resning efter l&aring;nga straff</li>
          <li>Elva fallbeskrivningar, som g&auml;ller individer som d&ouml;mts till f&auml;ngelse mer &auml;n tre &aring;r och sedan helt frik&auml;nts efter resning</li>
          <li>Slutsatser om brister och m&ouml;jliga &aring;tg&auml;rder (...) </li>
				</ul>
        <h3><a name="big_pharmas_venner" id="big_pharmas_venner"></a>- Big pharmas venner (Big Pharma's buddies) </h3>
        <p><a href="http://www.chron.com/disp/story.mpl/editorial/5810925.html">Big Pharma's buddies</a> (<span class="color_lightgreen">Big pharmas venner</span>)<br />
Editorial (<span class="color_lightgreen">Leder</span>)<br />
chron.com 1.6.2008<br />
Ankedomstol i Houston kaster ut kjennelse p&aring; 26,1 millioner dollar, griper inn i rollen til dommer og jury (...) (<span class="color_lightgreen">In throwing out a $26.1 million verdict, Houston appellate court usurps role of trial judge and jury</span>) </p>
        <p>I sin annonsering av anke i Ernst-saken, uttalte advokat Lanier at &quot;aktivistdommere beskytter n&aelig;ringslivsledere og eliminerer rettighetene til enker og ethvert annet offer for korporativ svikt.&quot; (<span class="color_lightgreen">In announcing an appeal in the Ernst case, attorney Lanier stated, &quot;activist judges are protecting corporate executives and stripping away the rights of widows and every other victim of corporate misconduct.&quot;</span>) </p>
        <p>Snarere enn &aring; oppmuntre Merck til &aring; gj&oslash;re det som er riktig, risikerer beslutning til 14th Courts i denne saken &aring; oppildne firmaet til &aring; stole p&aring; upartiske venner h&oslash;yt oppe i systemet for &aring; oppheve rettsavgj&oslash;relser slik at enker ikke f&aring;r ett r&oslash;dt &oslash;re. (...) (<span class="color_lightgreen">Rather than encouraging Merck to do what's right, the 14th Court's decision in the case risks emboldening the company to rely on judicial friends in high places to overrule juries and send widows home empty-handed</span>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/legemiddelindustrien.php"> Legemiddelindustrien (Big Pharma) (mintankesmie.no)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/statlig_legemiddelkontroll.php#mest_beundrede_lovbryter">USAs  mest beundrede lovbryter. (America's Most Admired Lawbreaker ) I løpet av 20 år utviklet Johnson &amp; Johnson et kraftig legemiddel, promoterte det ulovlig overfor barn og eldre, skjulte bivirkninger og tjente milliarder av dollar.  Dette er innsidehistorien. (Over the course of 20 years, Johnson &amp; Johnson  created a powerful drug, promoted it illegally to children and the elderly,  covered up the side effects and made billions of dollars. This is the inside  story.) (huffingtonpost.com 8.10.2015)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/antipsykotika.php#brystvevutvikling_og_infertilitet">Tjenestemenn  anklaget også firmaene for at de i markedsføringen av legemidler til barn hadde  unnlatt å opplyse om at Risperdal (risperidone) kan føre til hormonelle  ubalanser som kan føre til brystvevutvikling og infertilitet (barnløshet) hos  gutter og jenter. I markedsføringen av legemidlet for behandling av eldre  mennesker med demens hadde firmaet opprettet et salgsteam for omsorg for eldre,  til tross for at data fra en studie finansiert av Janssen som viste at  risperidon doblet risikoen for dødsfall blant eldre mennesker, ifølge statlige  tjenestemenn. BMJ 2015;351:h7018 (Published 31 December 2015)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/antipsykotika.php#mangedobler_risiko_for_lungebetennelse">-  Således ble bruk av antipsykotika knyttet til en doblet risiko for  lungebetennelse hos pasienter med AD (Alzheimers sykdom), og til og med en  høyere relativ risikoøkning (3,43 ganger) blant dem uten AD. (…) Resultatene  indikerer at bruk antipsykotika er knyttet til en høyere risiko for  lungebetennelse uavhengig av alder, anvendt studiedesign, behandlingsvarighet,  valg av legemidler eller samtidige sykdommer. (dgnews.docguide.com 30.8.2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  Among  antidementia drugs, memantine is associated with the highest risk of pneumonia.  A recent study from the University of Eastern Finland shows that among users of  antidementia drugs, persons using memantine have the highest risk of <a href="http://www.medicalnewstoday.com/articles/151632.php" title="Pneumonia: Causes, Symptoms and Treatments">pneumonia</a>. The use of  rivastigmine patches is associated with an increased risk as well. (<a href="http://www.medicalnewstoday.com/releases/314349.php">medicalnewstoday.com  24.11.2016</a>).)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/lover_lovdata_og_rettssikkerhet.php#publikum_onsker_toffere">Publikum  ønsker tøffere straffetiltak mot uansvarlig atferd i næringslivet. (-  Resultatene viste en sterk offentlig bekymring for skjevhet i rettssystemet) (theconversation.com  25.7.2016)</a>.)</p>
			          <h3>- Denne verksemda vil ikkje ta slutt før dei som legg til rette for hemmeleghald og skatteunndraging – bankar, advokatar og rådgjevarar – opplever ein reell risiko for å bli straffa for å utføre slike tenester.</h3>
                      <p>(<strong>Anm</strong>:  Superrike  skattesnytarar. (…) Denne verksemda vil ikkje ta slutt før dei som legg til  rette for hemmeleghald og skatteunndraging – bankar, advokatar og rådgjevarar –  opplever ein reell risiko for å bli straffa for å utføre slike tenester.) (<a href="http://www.mintankesmie.no/skatt_skattesvindel_og_skattemyndigheter.php#vil_ikkje_ta_slutt_for">dn.no  3.7.2017</a>).)                      </p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/eu_kommisjonen.php#eu_visste">EU-kommissionen  visste om VW-fusket. (- Misstankarna inom kommissionen väcktes till liv när  dess experter insåg att luftkvaliteten i städer inte förbättrades som förväntat  efter de strängare utsläppskraven för bilar som infördes 2007, enligt Der  Spiegel.) (nyteknik.se 15.7.2016)</a>.)</p>
			<p>(<strong>Anm</strong>:  Volkswagen mistenkt for å ha  villedet EUs investeringsbank. Volkswagen er mistenkt for å ha brukt et lån fra  Den europeiske investeringsbanken (EIB) til å utvikle teknologi som åpnet for  juks med utslippstester. Sjefen for den europeiske investeringsbanken (EIB)  Werner Hoyer er skuffet over Volkswagen. (<a href="https://www.dn.no/nyheter/2017/08/02/0634/Motor/volkswagen-mistenkt-for-a-ha-villedet-eus-investeringsbank?traffic_source=alert&amp;alert_type=topic&amp;alert_name=Nyhetsvarsel%3a+Bil">dn.no  2.8.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  VW-chef  erkänner bedrägeri. En högt uppsatt chef på tyska Volkswagen (VW) i USA,  inblandad i avgasskandalen, erkänner bedrägeri, meddelade en talesperson för  domstolen i Detroit på tisdagen. (<a href="https://www.nyteknik.se/fordon/vw-chef-erkanner-bedrageri-6862583?source=carma&amp;utm_custom%5bcm%5d=302879704,33270&amp;utm_campaign=mail4">nyteknik.se  26.7.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  VW-topp  sier seg skyldig – risikerer 169 år i fengsel. Den tidligere VW-toppen i USA,  Oliver Schmidt, innrømmer å ha forsøkt å dekke over utslippsjukset. Nå  risikerer han mange år bak murene. (<a href="http://www.tv2.no/broom/9266233/">tv2.no  28.7.2017</a>).)</p>
                      <p>(<strong>Anm</strong>: Oliver  Schmidt jailed for seven years for Volkswagen emissions scam. Judge in Detroit  imposes $400,000 fine on former VW executive. German was arrested trying to  return home from holiday in Florida (<a href="https://www.theguardian.com/business/2017/dec/06/oliver-schmidt-jailed-volkswagen-emissions-scam-seven-years">theguardian.com  6.12.2017</a>).)</p>
                      <p>(<strong>Anm</strong>: «Dieseljukset»  ga betydelig oppjusterte utslipp. Utslippene fra dieseldrevne personbiler de  siste årene er justert opp med opp mot 30 prosent som følge av det såkalte  utslippsjukset. (<a href="http://www.ssb.no/natur-og-miljo/artikler-og-publikasjoner/ny-beregningsmetode-gir-okte-utslipp--332863">ssb.no  14.12.2017</a>).)</p>
                      <p>(<strong>Anm</strong>: Disse  bildene viser det enorme problemet Volkswagen står oppe i. (…) Juks med  dieselutslipp har enorme proposjoner. Dieselskandalen som VW-konsernet har  havnet i har proposjoner det nesten er vanskelig å fatte. (…) Av de rundt  600.000 dieselbilene som er solgt i landet som omfattes av skandalen, har  bilgiganten forpliktet seg til å kjøpe tilbake over 500.000 biler. 350.000 av  disse kjøpene er allerede gjennomført til en kostnad på 7,4 milliarder dollar. (<a href="https://www.nettavisen.no/na24/disse-bildene-viser-det-enorme-problemet-volkswagen-star-oppe-i/3423446579.html">nettavisen.no  19.4.2018</a>).)</p>
                      <p>(<strong>Anm</strong>:  Tidligere  Volkswagen-ingeniør dømt til fengsel. En tidligere ingeniør i Volkswagen får 40  måneders fengsel etter Volkswagen-skandalen. (<a href="http://www.vg.no/nyheter/utenriks/dieselskandalen/tidligere-volkswagen-ingenioer-doemt-til-fengsel/a/24126569/">vg.no  25.8.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  Dieselskandalen  truer tysk økonomi. Den tyske dieselskandalen utgjør en risiko for landets  økonomi, opplyser Tysklands finansdepartement i en rapport mandag. Dieselskandalen  oppsto for nesten to år siden, da det ble kjent at Volkswagen jukset med  utslippstallene. Her monterer tyske arbeidere dieselmotorer på en  Volkswagen-fabrikk i Chemnitz i Tyskland.&nbsp;(<a href="https://www.dn.no/nyheter/2017/08/21/1300/Utenriks/dieselskandalen-truer-tysk-okonomi">dn.no  21.8.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  -1200 vil  dø av utslipp fra Volkswagens «juksebiler». Amerikanske forskere har undersøkt  konsekvensene av utslippsjuks. (…) Det er forskere ved universitetet MIT i USA  som har <a href="http://news.mit.edu/2017/volkswagen-emissions-premature-deaths-europe-0303">sett nærmere</a> på konsekvensene av Volkswagens utslippsjuks. (<a href="http://www.dagbladet.no/nyheter/1200-vil-do-av-utslipp-fra-volkswagens-juksebiler/67365759">dagbladet.no  3.3.2017</a>).) </p>
                      <p>(<strong>Anm</strong>:  Dieseljuks. Forskere har funnet den skjulte koden i  juksebilene til Volkswagen. Gikk langt for å hindre at det var mulig å teste  det virkelige utslippet. (…) Nå har de funnet svaret, gjemt i programvaren til  bilene, <a href="http://ucsdnews.ucsd.edu/pressrelease/researchers_find_computer_code_that_volkswagen_used_to_cheat_emissions_test">melder</a> University of California San Diego.&nbsp;(…) Resultatene er publisert i en  rapport (<a href="https://www.ieee-security.org/TC/SP2017/papers/101.pdf">PDF</a>),  som blir lagt frem frem under IEEE Symposium on Security and Privacy i San  Francisco denne uken. Under vanlig bruk, slipper bilene ut inntil 40 ganger mer  NOx enn tillatt.&nbsp;Utslippsavsløring:&nbsp;<a href="https://www.tu.no/artikler/nye-dieselgate-funn-bilprodusentene-skrur-av-eksosrensing-allerede-ved-17-grader/347699">Skrur av  eksosrensingen allerede ved 17 grader</a> (<a href="https://www.tu.no/artikler/forskere-har-funnet-den-skjulte-koden-i-juksebilene-til-volkswagen/387750">tu.no 23.5.2017</a>).) </p>
<p>(<strong>Anm</strong>:  Research. The  Volkswagen Emissions Scandal Could Shorten Thousands of Lives, Study Says (<a href="http://time.com/4689276/volkswagen-emissions-scandal-lives/?xid=newsletter-health">time.com  3.3.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:   VW-sjef pågrepet i USA En høytstående sjef i Volkswagen i USA har i kjølvannet  av dieselskandalen blitt pågrepet av FBI, mistenkt for bedrageri, ifølge The  New York Times. Oliver Schmidt ble ifølge den amerikanske avisa pågrepet lørdag.  (<a href="https://www.nrk.no/nyheter/vw-sjef-pagrepet-i-usa-1.13313071">nrk.no 9.1.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  Volkswagen  må betale 36 milliarder kroner etter utslippsjukset. (<a href="http://www.aftenposten.no/verden/Volkswagen-ma-betale-36-milliarder-kroner-etter-utslippsjukset-612833b.html">aftenposten.no  11.1.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  Volkswagen  trolig spart for milliarder i USA. En dommer i USA har avvist et søksmål mot  Volkswagen, noe som kan spare den tyske bilprodusenten for milliarder av dollar  i utbetalinger. Avgjørelsen kan avskrekke en rekke amerikanske stater fra å  saksøke Volkswagen etter utslippsskandalen som har fulgt bilprodusenten i  nesten to år. Den føderale dommeren Charles Breyer avviste søksmålet fra  delstaten Wyoming med henvisning til at den aktuelle forurensningsloven må  reguleres sentralt og ikke av de amerikanske delstatene. (<a href="https://www.dn.no/nyheter/2017/09/01/0517/Motor/volkswagen-trolig-spart-for-milliarder-i-usa?traffic_source=alert&amp;alert_type=topic&amp;alert_name=Nyhetsvarsel%3a+Bil">dn.no  1.9.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://e24.no/bil/dieselskandalen/tysk-avis-vw-sjefen-godkjente-dekkoperasjon/23803896">Tysk  avis: VW-sjefen godkjente dekkoperasjon. Martin Winterkorn, avgått konsernsjef  i Volkswagen, godkjente en plan om å holde tilbake informasjon fra amerikanske  myndigheter, skriver Bild. (e24.no 26.9.2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  VW må  betale 2,8 milliarder dollar i bot for dieseljuks. Beløpet tilsvarer over 24  milliarder kroner. (<a href="http://www.dagbladet.no/nyheter/vw-ma-betale-28-milliarder-dollar-i-bot-for-dieseljuks/67507360">dagbladet.no  21.4.2017</a>).)</p>
					  <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/skatt_skattesvindel_og_skattemyndigheter.php#nobelprisvinner_trekker_seg">Nobelprisvinner  trekker seg fra Panama-gransking. (…) Begrunnelsen er at granskingen  vanskeliggjøres av hemmelighold og manglende åpenhet.) (…) Pieth sier det blant  annet finnes beviser for hvitvasking av penger fra barneprostitusjon i  Panama-dokumentene. (dn.no 6.8.2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/habilitet.php#er_meningslost">Margaret  McCartney: Valgfri offentliggjøring av utbetalinger er meningsløst. (Margaret  McCartney: Optional disclosure of payments is pointless.) (- Og åpenhet  anskueliggjør problemene: bør de som mottar tusenvis av pund fra industrien som  &quot;påtenkte ledere&quot; sitte i paneler for utarbeidelse av nasjonale  retningslinjer eller hjelpe til med å stake ut regjeringens politikk?) BMJ  2016;354:i3692 (Published 01 July 2016)</a>.)</p>
                      <p>(<strong>Anm</strong>: For mange retningslinjer for  behandlinger er skrevet av eksperter med økonomiske konflikter, ifølge studie.  (Too many treatment guidelines are written by experts with financial conflicts,  study finds.) (<a href="http://www.mintankesmie.no/retningslinjer_og_veiledere.php#eksperter_med_okonomiske_konflikter">statnews.com  22.8.2016</a>).)</p>
<p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/habilitet.php#er_offentlig">Naturlig at dette  er offentlig. OUS-lege Elisabeth Gulowsen Celius samtykket til offentliggjøring  av honorarer. Hun er kritisk til kolleger som ikke har gjort det samme. – Det  kan reise spørsmål om det er bindinger som ikke tåler dagens lys. (dagensmedisin.no  12.8.2016)</a>.)</p>
<p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/gratis_lunch_legemidler_gradighetskultur_og_korrupsjon.php#ett_enkelt_gratis_måltid">Resultater publisert i JAMA Internal Medicine antyder at ett enkelt gratis måltid kan øke  sannsynligheten for at en lege vil foreskrive et bestemt legemiddel. (Findings  published by JAMA Internal Medicine suggest that even a single free meal can  boost the likelihood a doctor will prescribe a certain drug) (online.wsj.com 20.6.2016)</a>.)</p>
<p>(<strong>Anm</strong>:  <a href="http://www.fiercepharma.com/pharma/fda-s-advisors-opioids-booted-for-ties-to-industry-ap-learns">FDAs  rådgivere på opioider sparket grunnet bånd til industrien, ifølge AP. (FDA's  advisers on opioids booted for ties to industry, AP learns. Having been  buffeted by controversy over its approval of addictive opioid drugs, the FDA is  calling on a panel of experts to help it sort through the thorny issue. But  even before the new panel met, it has been tinged by controversy itself,  dismissing four advisers because of perceived ties to drugmakers.) (fiercepharma.com  8.7.2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.lmi.no/aktuelt-fra-lmi/2016/06/offentliggjoering-av-verdioverfoeringer">Offentliggjøring  av verdioverføringer. Legemiddelindustrien offentliggjør i dag alle  verdioverføringer til helsepersonell og helseforetak. (lmi.no 30.6.2016)</a>.)                      </p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/habilitet.php#ikke_lenger_valgfritt">Leder. Disclosure  UK: åpenhet (offentliggjøring) bør ikke lenger være valgfritt BMJ. (Editorials.  Disclosure UK: transparency should no longer be an optional extra) BMJ  2016;354:i3730 (Published 06 July 2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/habilitet.php#illusjon_av">Disclosure  UKs nettsted gir en &quot;illusjon av åpenhet&quot;, sier Goldacre (Disclosure  UKs nettsted gir en &quot;illusjon av åpenhet&quot;, sier Goldacre) (Disclosure  UK website gives &ldquo;illusion of transparency,&rdquo; says Goldacre) BMJ  2016;354:i3760BMJ 2016; 354 (Published 06 July 2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://bmjopen.bmj.com/content/6/8/e011997?cpetoc">Reporting of financial  and non-financial conflicts of interest by authors of systematic reviews: a methodological  survey. (…) Conclusions Although close to half of the published systematic  reviews report that authors (typically many) have conflicts of interest, more  than half report that they do not. Authors reported individual conflicts of  interest more frequently than institutional and non-financial conflicts of  interest. BMJ Open 2016;6:e011997</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/legemiddelindustrien.php#inntektene_fra_legemiddelfirmaer">-  Legene som deklarerte de høyeste inntektene fra legemiddelfirmaer i  Storbritannias nye database uttaler at åpenhet om utbetalingene bør være  obligatorisk. (The doctors who declared the most earnings from drug companies  in the United Kingdom&rsquo;s new database have said that being transparent about  payments should be mandatory.) BMJ 2016;354:i3716 (Published 04 July 2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  Leger  som mottar de største utbetalingene fra legemiddelfirmaer deklarerer dem ikke  på nytt nettsted. (Doctors getting biggest payments from drug companies don&rsquo;t  declare them on new website. <a href="http://www.mintankesmie.no/legemiddelindustrien.php#deklarerer_ikke">BMJ 2016;354:i3679 (Published 01 July 2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.bmj.com/content/354/bmj.i4189?utm_medium=email&amp;utm_campaign_name=201608232&amp;utm_source=etoc_daily">Association  between payments from manufacturers of pharmaceuticals to physicians and  regional prescribing: cross sectional ecological study. BMJ 2016;354:i4189  (Published 18 August 2016)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/medisinsk_utstyr.php">Medisinsk utstyr (mintankesmie.no)</a>.) </p>
                      <p>(<strong>Anm</strong>:  <a href="https://www.statnews.com/pharmalot/2016/06/30/doctors-payments-drug-firms-device-makers/?s_campaign=stat:rss">Legemiddelprodusenter  og medisinske utstyrsprodusenter betalte i fjor 6,5 milliarder dollar til leger og  undervisningssykehus. (Drug and device makers paid $6.5 billion to docs and  teaching hospitals last year.) (statnews.com 30.6.2016)</a>.)</p>
        <p><a name="unntaket_som" id="mulige_konsekvenser"></a><a href="http://bmj.bmjjournals.com/cgi/content/full/328/7434/243?maxtoshow=&amp;HITS=10&amp;hits=10&amp;RESULTFORMAT=&amp;andorexactfulltext=and&amp;searchid=1135200789474_12806&amp;FIRSTINDEX=0&amp;sortspec=relevance&amp;volume=328&amp;firstpage=243&amp;resourcetype=1">Judge may report drug company executive to attorney general</a> (<span class="color_lightgreen">Dommer innrapporterer muligens leder i legemiddelfirma til riksadvokaten</span>)<br />
  BMJ 2004;328:243 (31 January)<br />
  En dommer i lagmannretten vurderer &aring; rapportere en seniorleder hos GlaxoSmithKline til riksadvokaten etter at han i en patentsak fortalte motpartens ekspertvitne at firmaet i framtiden ikke ville finansiere hans forskning. (...) (<span class="color_lightgreen">A high court judge is considering reporting a senior executive of GlaxoSmithKline to the attorney general after he told an expert witness appearing for the company&rsquo;s opponents in a patent action that the company would not fund any research by him in the future</span>.)</p>
        <p>Dommeren reagerte etter at professor Clive Page, en ekspert p&aring; astma fra King&rsquo;s College, London, som m&oslash;tte som ekspertvitne for det generiske legemiddelfirmaet Cipra, vitnet om en oppringning han hadde f&aring;tt fra dr. Rapeport, direkt&oslash;r for klinisk farmakologi hos Glaxo. Professor Page sa at lederen, som er medisinsk utdannet i S&oslash;r-Afrika, fortalte ham at, selv om hans n&aring;v&aelig;rende forskningsbevilling ville fortsette, ville han ikke motta ytterligere finansiering fra Glaxo i fremtiden. (<span class="color_lightgreen">The judge acted after Professor Clive Page, an asthma expert from King&rsquo;s College, London, who was appearing as a witness for the generic drugs company Cipra, gave evidence about a phone call he had received from Dr Rapeport, director of clinical pharmacology at Glaxo. Professor Page said the executive, who qualified in medicine in South Africa, told him that, although his current research grant would continue, he would get no more funding from Glaxo in future</span>.)</p>
        <p> Han sa klart fra til meg at jeg ikke kunne ha det samme forhold til Glaxo i fremtiden, og at jeg ikke lenger var en venn av Glaxo og at jeg derfor ikke ville motta noen framtidig st&oslash;tte,&rdquo; fortalte professor Page dommeren. (<span class="color_lightgreen">He clearly said to me that I could not have the same relationship with Glaxo in the future, and that I was no longer a friend of Glaxo and, therefore, I would not be receiving future funding,&rdquo; Professor Page told the judge</span>.)</p>
        <p>Dommeren p&aring;pekte overfor dr. Rapeport at funksjonen til et ekspertvitne var &rdquo;&aring; assistere retten, ikke &aring; assistere en spesiell part.&quot; (<span class="color_lightgreen">The judge pointed out to Dr Rapeport that the function of an expert witness was &ldquo;to assist the court, not to assist any particular party.&quot;</span>)</p>
        <p>Dr. Rapeport sa: &rdquo;Jeg aksepterer at jeg handlet upassende og ber om uskyldning for dette. Det vil ikke skje igjen. Han forsikret dommeren at professor Pages framtidige tilskudd og forskningsprogram ville bli vurdert p&aring; &rdquo;n&oslash;yaktig p&aring; det samme grunnlag som hittil.&quot; (<span class="color_lightgreen">Dr Rapeport said: &ldquo;I accept that I acted inappropriately and I apologise for my action. It will not happen again.&rdquo; He assured the judge that Professor Page&rsquo;s future applications for research grants would be considered on &ldquo;exactly the same basis as heretofore.&quot;</span>)</p>
        <p>Dommeren sa de n&aring; m&aring;tte overveie hvorvidt saken skulle forf&oslash;lges videre. I s&aring; fall ville han sende beviset til riksadvokaten for &aring; avgj&oslash;re hva som skulle videre skulle gj&oslash;res. (<span class="color_lightgreen">The judge said he now had to consider whether to take the matter further. If he did, he would send the evidence to the attorney general to decide what steps to take.</span>)</p>
        <p> Riksadvokaten kan rettsforf&oslash;lge enhver, som fors&oslash;ker &aring; legge hindringer i veien for et vitne, for &aring; vise forakt for retten. Straffen varierer fra bot til fengselsstraff. (...) (<span class="color_lightgreen">The attorney general can take proceedings for contempt of court against anyone who attempts to interfere with a witness. Penalties range from a fine to a prison term</span>.)</p>
        <h3>- Retten til forsvarlig rettergang</h3>
        <p><a name="rettigheter_for_hvem" id="rettigheter_for_hvem"></a><a href="D&#216;MT.%20Det%20er%20neppe%20smart%20&#229;%20la%20skatteforvaltningen,%20som%20er%20d&#248;mt%20i%20H&#248;yesterett">Rettigheter for hvem?</a><br />
          aftenposten.no 2.8.2008<br />
          ANDERS RYSSDAL, 
        advokat <br />
        D&Oslash;MT. Det er neppe smart &aring; la skatteforvaltningen, som er d&oslash;mt i H&oslash;yesterett<br />
        fire ganger p&aring; to &aring;r, f&oslash;re tilsyn med overholdelsen av menneskerettighetene. (...)</p>
        <p>l kronikken 19. mai tok Anders-Ryssdal tfl orde for 
          &aring; f&aring; for eksempel retten til forsvarlig rettergang, 
          forbud mot dobbeltstraff, krav p&aring; strafferettslig<br />
          behandling av det som reelt er strafferettslig anklage 
          (f.eks. tilleggsskatt), rett til anke og rett til 
        privatlivets fred inn i Grunnloven. (...) </p>
        <p><a href="http://www.aftenposten.no/meninger/debatt/article2476447.ece">En mer realistisk debatt</a><br />
        THORBJ&Oslash;RN GJ&Oslash;LSTAD, ekspedisjonssjef Finansdepartementet<br />aftenposten.no 10.6.2008<br />
        GRUNNLOVSDEBATT. Det har ikke mye for seg at Grunnloven skal overta lovgivningens mer konkrete rettighetsutforming p&aring; flere omr&aring;der enn i dag. (...)</p>
        <p><strong>Stortingets rolle. </strong><br />
        I motsetning til Ryssdal mener jeg at de reelle maktforholdene i det &oslash;verste statsstyret samsvarer godt med Grunnlovens formelle innhold. Denne viktige del av innholdet trenger derfor ikke noen inng&aring;ende revisjon. Parlamentarismen er innf&oslash;rt gjennom &sect; 15.</p>
        <p>Stortingets lovgivnings- og bevilgningskompetanse etter Grunnloven er en tydelig markering av de reelle maktforhold. Det er Stortinget som bestemmer, selv om Regjeringens forslags- og initiativrett ogs&aring; gir en viktig og n&oslash;dvendig maktposisjon. Kongens alminnelige myndighet etter Grunnloven er underlagt &sect; 31 om statsministerens kontrasignatur, det vil si at monarken bare kan bestemme det som Regjeringen vil.</p>
        <p>Det er bare misvisende &aring; hevde at Grunnloven er alvorlig misvisende om disse maktforholdene. (...) </p>
        <p><a href="http://www.aftenposten.no/meninger/kronikker/article2429870.ece">Bring rettighetene hjem</a><br />
          ANDERS RYSSDAL, leder i Advokatforeningen, <br />
leder, Den norske Advokatforening<br />
          aftenposten.no 19.5.2008<br />
        I Norges grunnlov kan vi ikke lese noe om hvilke rettigheter norske borgere har og b&oslash;r ha. Skyldes det endringsmotvilje?</p>
        <p> Suverenitet. Ved hvert &aring;rhundreskifte feires runde jubileer i Norge. For rundt 200 &aring;r siden fikk vi v&aring;r Grunnlov, og for 100 &aring;r siden v&aring;r folkerettslige suverenitet som nasjon. Det underlige er at Grunnloven kom 100 &aring;r f&oslash;r suvereniteten; for de fleste nasjoner er det omvendt. </p>
        <p> Som et resultat har Norge verdens nest eldste forfatning, bare sl&aring;tt av USA. Men i motsetning til den amerikanske forfatning, som spr&aring;klig og statsrettslig er et levende dokument, lider Grunnloen i et n&aring;tidsperspektiv av store svakheter. (...)        </p>
        <h3><a name="lovverket_tilhorer_de_rike" id="lovverket_tilhorer_de_rike"></a>- Og lovverket, det tilh&oslash;rer ogs&aring; de rike</h3>
        <p><a href="http://www.nrk.no/kanal/programoversikt/?p_otr_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
cannot generate system identifier for general entity "p_otr_sendedato"
Line: 4889, Col: 89
…moversikt/?p_otr_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19…
reference not terminated by REFC delimiter
Line: 4889, Col: 104
…r_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal…
reference to external entity in attribute value
Line: 4889, Col: 104
…r_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal…
cannot generate system identifier for general entity "p_otr_anntid"
Line: 4889, Col: 114
…OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_kn…
reference not terminated by REFC delimiter
Line: 4889, Col: 126
…&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p…
reference to external entity in attribute value
Line: 4889, Col: 126
…&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p…
cannot generate system identifier for general entity "p_otr_kanal"
Line: 4889, Col: 133
…sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikk…
reference not terminated by REFC delimiter
Line: 4889, Col: 144
…0080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Pa…
reference to external entity in attribute value
Line: 4889, Col: 144
…0080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Pa…
cannot generate system identifier for general entity "p_knapp"
Line: 4889, Col: 150
…0&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om …
reference not terminated by REFC delimiter
Line: 4889, Col: 157
…_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</…
reference to external entity in attribute value
Line: 4889, Col: 157
…_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</…
cannot generate system identifier for general entity "p_artikkel_id"
Line: 4889, Col: 165
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
reference not terminated by REFC delimiter
Line: 4889, Col: 178
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
reference to external entity in attribute value
Line: 4889, Col: 178
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
general entity "p_otr_sendedato" not defined and no default entity
Line: 4889, Col: 89
…moversikt/?p_otr_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19…
reference to entity "p_otr_sendedato" for which no system identifier could be generated
Line: 4889, Col: 104
…r_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal…
general entity "p_otr_anntid" not defined and no default entity
Line: 4889, Col: 114
…OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_kn…
reference to entity "p_otr_anntid" for which no system identifier could be generated
Line: 4889, Col: 126
…&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p…
general entity "p_otr_kanal" not defined and no default entity
Line: 4889, Col: 133
…sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikk…
reference to entity "p_otr_kanal" for which no system identifier could be generated
Line: 4889, Col: 144
…0080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Pa…
general entity "p_knapp" not defined and no default entity
Line: 4889, Col: 150
…0&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om …
reference to entity "p_knapp" for which no system identifier could be generated
Line: 4889, Col: 157
…_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</…
general entity "p_artikkel_id" not defined and no default entity
Line: 4889, Col: 165
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
reference to entity "p_artikkel_id" for which no system identifier could be generated
Line: 4889, Col: 178
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
          nrk.no 30.9.2008 (NRK1 tirsdag 30. september kl 19.55)<br />
        Ansikt til ansikt: Morten Krogvold har m&oslash;tt Ole Paus. </p>
        <p> N&aring;r Morten Krogvold m&oslash;ter Ole Paus, blir det mye snakk om nasjonen Norge. Den folkekj&aelig;re artisten betrakter landet med sitt sedvanlige, skjeve og humoristiske blikk. (...)</p>
        <p><strong>- Skriv det som kan skade deg mest</strong><br />
        Ole Paus forteller om sine venner og om de som har inspirert ham. Jens Bj&oslash;rneboe ga ham en gang et r&aring;d; - er du i tvil om hva du skal skrive, s&aring; skriv det som kan skade deg mest.</p>
        <p>Det er kanskje slik Ole Paus har blitt en av v&aring;re viktigste bidragsytere i samfunnsdebatten, med og uten gitar. (...)
</p>
        <p>Video: <a href="http://www1.nrk.no/nett-tv/klipp/418240">Ansikt til ansikt - Ole Paus</a> (...) </p>
        <p><strong>Utdrag</strong>: </p>
        <p>Vi er oppdratt til &aring; tro at Norge er et fritt land. Det er ikke det. Norge har aldri v&aelig;rt mindre fritt enn n&aring;. (&hellip;) Jeg tenker b&aring;de p&aring; det politiske systemet (&hellip;) Hvor det ikke er et parti som ikke st&aring;r for noe. (...) De g&aring;r bare rundt og venter p&aring; noen &aring; parre seg med, slik at de kan avle frem et regjeringsalternativ, alle sammen, og det er ikke rare holdningene. (&hellip;) </p>
        <p>Og lovverket, det tilh&oslash;rer ogs&aring; de rike. De som har muskler til det. Jeg husker da jeg gikk til rettssak mot Se og H&oslash;r, og vant to ganger. F&oslash;rst i byretten og s&aring; i lagmannsretten. Hvis jeg ikke hadde vunnet, s&aring; hadde jeg v&aelig;rt virkelig nede for telling. Jeg var ikke klar over det, at regningen, for &aring; f&aring; en symbolsk oppreisning p&aring; 10 000 kroner, kom p&aring; 380 000. For Se og H&oslash;r var ikke det noe problem. Det er omtrent det de betaler for et gjennomsnitts bryllup. Men for meg ville det v&aelig;rt en katastrofe. Rettsvesenet tilh&oslash;rer da den som kan betale for det. Et alminnelig menneske m&aring; v&aelig;re enten spik spenna g&aelig;rn, eller fryktelig fortvilet for &aring; g&aring; den veien. Og muligheten til &aring; bli h&oslash;rt i det norske samfunnet, alts&aring; i gamle dager kunne man g&aring; til sin stortingsrepresentant, da lot det seg gj&oslash;re, da kunne man n&aring; frem. Men n&aring; i dag s&aring; m&aring; du enten ha en mediekonsulent eller en som kan formidle budskapet ditt, og det er dyrt. Eller s&aring; saken m&aring; v&aelig;re spektakul&aelig;r nok til &aring; komme i media. Men ellers s&aring; blir du ikke h&oslash;rt. S&aring; menneskene i dette landet er p&aring; en m&aring;te ekskludert fra sin egen virkelighet, og det er farlig. (&hellip;) Noe har faktisk skjedd med dette landet her, alts&aring; vi er blitt avv&aelig;pnet alle sammen. (...)</p>
        <p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/dommere_og_domstoler.php">Dommere og domstoler (mintankesmie.no).</a>)</p>
        <p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/lover_lovdata_og_rettssikkerhet.php">Lover (lovdata.no) og rettssikkerhet (mintankesmie.no)</a>.) </p>
        <p>(<strong>Anm</strong>: <a href="http://www.mintankesmie.no/logn_pisspreik_eller_sannhet.php">Løgn, pisspreik (bullshit) eller sannhet? (L&oslash;gn i norske rettssaler) (mintankesmie.no)</a>.)</p>
        <h3>- Jusens tilslørte språk </h3>
        <p><a href="http://www.aftenposten.no/meninger/debatt/article3680053.ece">Jusens tilslørte språk</a><br />
  ANNE-METTE PRENT - Oslo<br />
  aftenposten.no 4.6.2010<br />
  Anne-Mette Prent våknet av at mannen, Tom Prent, ble drept i sengen ved siden av henne. (...)</p>
        <p>Vi som har opplevd norsk rettspraksis, har fått innsikt i jusens språklige verden, en verden vi så gjerne skulle vært spart for. I rettssalen gjelder det å tildekke. Mitt vitnemål måtte være så nøytralt som mulig, jeg var best tjent med å ordlegge meg neddempet og forsiktig. Aktorat, forsvarer og dommere må for all del ikke se for seg åstedets brutale gru, ikke høre for sitt indre øre offerets gutturale skrik om hjelp, sterke ord og uttrykk kunne virke provoserende på dem som er satt til å heve lov og rett. Det sminkede språket lever sitt eget liv i norske rettssaler, skulle du slumpe til å bryte de hemmelige kodene, blir du klubbet ned, det er nemlig ikke «jus!». (...) </p>
        <p><strong>Maktens autoritet </strong><br />
          Noen av oss lever med den naive forestillingen at en rettssak er til for å oppnå en slags rettferdighet. Siden staten gjennom rettsvesenet er pålagt å dømme og straffe, er ofre og pårørende tilskuere til prosessen. Vi er gjort maktesløse, har ikke krav på annet enn medlidenhet. Gjennom det tildekkende juristspråket oppleves denne prosessen ytterligere fornedrende; først påføres vi svære traumer ved det tapet vi har lidt, så forsterkes dette gjennom rettsvesenets umenneskeliggjøring. Maktens autoritet, de som definerer og bestemmer over våre liv, har oppnådd det som var hensikten, nemlig å få oss taust til å godta de premissene de har lagt.</p>
        <p>Rettssystemets undertrykkende funksjon i vårt samfunn blir ytterligere forsterket gjennom lagrettens rett til å si kun «ja» eller «nei» i skyldspørsmålet. Hvor ellers i samfunnet får vi være så stumme? Politi, skole og helsevesen, alle må grunngi sine avgjørelser, avgjørelser som griper dypt inn i den enkeltes liv.</p>
        <p><strong>Språket tapte</strong> <br />
  Da lagretten frifant min manns drapsmann, uten å måtte begrunne frifinnelsen med ett ord, da hadde språket tapt og uvettet vunnet. Et samfunn som holder seg med et slikt system, fortjener ikke annet enn at «de verste» blant oss får gå fri. Når vi ikke kan verge oss bedre, må vi finne oss i vår avmakt. Vi får de politikerne vi fortjener og det juridiske systemet de tillater. (...) </p>
        <h3><a name="enn_sverdet" id="ennsverdet"></a>- Pennen er mektigere enn sverdet</h3>
        <p><a href="http://en.wiktionary.org/wiki/the_pen_is_mightier_than_the_sword">Pennen er mektigere enn sverdet</a> (<span class="color_lightgreen">The pen is mightier than the sword</span>)<br />
  en.wiktionary.org (2.3.2010)<br />
  This phrasing due to <a href="http://en.wikipedia.org/wiki/Edward_Bulwer-Lytton">Bulwer-Lytton</a> 1839, in his play Richelieu; Or the Conspiracy:</p>
        <p>Beneath the rule of men entirely great, The pen is mightier than the sword. (...)</p>
        <p>Ord som v&aring;pen<br />
  Bokspeilet 1999;24(9)<br />
&laquo;Ord bereder veien for kommende gjerninger, de er gnister som tenner kommende b&aring;l,&raquo; hevdet Franz Kafka. Kraften og makten som ligger i ordene, gj&oslash;r dem til et kraftig v&aring;pen mot makthavernes overgrep. (...) </p>
        <p>Ord er v&aring;pen, men som Kafka ogs&aring; sier det: &laquo;Ord er trylleformler&raquo;. Isabel Allende er nettopp en forfatter som b&aring;de bruker ordene som v&aring;pen og samtidig fryder seg over deres fortryllende egenskaper. (...) </p>
        <p>(<strong>Anm</strong>:  <a href="http://nyheter.uib.no/?modus=vis_kronikk&amp;id=46921">Prosessen om Kafka (uio.no 23.8.2010)</a>.)</p>
        <p>(<strong>Anm</strong>:  <em>What makes something &quot;Kafkaesque&quot;?</em> - Noah Tavlin (<a href="http://ed.ted.com/lessons/what-makes-something-kafkaesque-noah-tavlin?utm_source=TED-Ed+Subscribers&amp;utm_campaign=53b05ddeb7-2013_09_219_19_2013&amp;utm_medium=email&amp;utm_term=0_1aaccced48-53b05ddeb7-47264377">ed.ted.com</a>).)</p>
          <p>(<strong>Anm</strong>:  Fluer og  frihet i to Kafka-romaner. Norsk Litteratur­vitenskapelig. Franz Kafkas  forfatterskap er et yndet emne innenfor såkalte animal studies, en tverrfaglig  disiplin med forbindelser til litteraturvitenskapen.1 Særlig Kafkas kortprosa  innbyr til lesninger av denne sorten, ettersom dyr av ulike arter er sentrale i  disse fortellingene – enten det dreier seg om det lille skadedyret, Gregor  Samsa («Die Verwandlung»), eller om den mer antropomorfe apen, Rotpeter («Ein  Bericht für eine Akademie»). <a href="https://www.idunn.no/nlvt/2017/01/fluer_og_frihet_i_to_kafka-romaner">Tidsskrift  01 / 2017 (Volum 19) Side: 22-39</a>.)</p>
<h3><a name="introduce_sunshine" id="introduce_sunshine"></a>- Senatorer introduserer &quot;Sunshine&quot; i lovvedtak </h3>
        <p><a href="http://legaltimes.typepad.com/blt/2011/02/senators-introduce-sunshine-in-the-courtroom-act.html">Senators Introduce Sunshine in the Courtroom Act</a> (<span class="color_lightgreen">Senatorer introduserer &quot;Sunshine&quot; i lovvedtak</span>)<br />
  legaltimes.typepad.com 18.2.2011<br />
  Sens. Chuck Grassley (R-Iowa), Charles Schumer (D-N.Y.) and Patrick Leahy (D-Vt.) have introduced legislation to permit federal and appellate judges to allow the use of cameras in the courtroom. </p>
        <p> “The judicial branch of our federal government is a mystery to many Americans. Cameras in courtrooms would help lift the veil of secrecy and contribute to greater public understanding of the judicial system,” Grassley said in a written statement. </p>
        <p> The Sunshine in the Courtroom Act doesn’t require federal court judges to allow cameras but instead gives them discretion to permit cameras or other electronic media access if they see fit. The bill directs the Judicial Conference of the United States, the principal policy-making entity for the federal courts, to draft non-binding guidelines for judges to refer to when making a decision regarding media coverage of a particular trial. (...) </p>
        <p>(<strong>Anm</strong>:  <a href="http://tidsskriftet.no/index.php?seks_id=1972403">Leder. En solskinnshistorie. Tidsskr Nor Legeforen 2010; 130:919 (6.5.2010)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://postscript.communitycatalyst.org/?p=3130">Where’s the Sunshine?          (postscript.communitycatalyst.org 7.11.2011)</a>.)</p>
        <p><a href="http://www.reuters.com/article/2012/06/01/us-doctor-sunshine-laws-idUSBRE8501DN20120601RELATED%20NEWS">Do doctor-payment sunshine laws work?</a> (<span class="color_lightgreen">Virker "solskinnslover&quot; for lege-utbetalinger?)</span><br />
          REUTERS.COM 1.6.2012<br />
(Reuters Health) - The mere passage of a law that requires drug companies to disclose how much money they pay doctors may not change physician prescribing practices, suggests a new study.</p>
        <p> In two states that passed so-called sunshine laws requiring drugmakers to disclose payments, doctors' choices of which drugs to prescribe for their patients did not differ much from those of peers in states without such a law.</p>
        <p> However, since the disclosure of information was to state agencies, not the general public, the state laws were less likely to influence doctors' behavior, one expert not involved in the research noted.</p>
        <p>&quot;It was a way of doing a quick analysis to even see if there was an impact we could measure,&quot; said Kavita Nair, the study's senior author and a associate professor at University of Colorado School of Pharmacy in Aurora.</p>
        <p> Nair and her colleagues said they were trying to gauge the potential effect of a nationwide disclosure requirement. (...) </p>
        <p>(<strong>Anm</strong>:  <a href="http://archinte.jamanetwork.com/article.aspx?articleid=1170047">Effect of Physician Payment Disclosure Laws on Prescribing. Arch Intern Med. 2012;172(10):819-821 (May 28)</a>.)</p>
        <p><a href="http://jama.ama-assn.org/cgi/content/full/297/11/1255?etoc">Sunshine Laws and the Pharmaceutical Industry</a> (<span class="color_lightgreen">&quot;Solskinnslover&quot; og legemiddelindustrien</span>)<br />
  JAMA. 2007;297:1255-1257<br />
  Recent research would suggest that the US public should be pleased with the role the pharmaceutical industry plays in advancing public health. (...)</p>
        <p>So why is there so much dissatisfaction with the pharmaceutical industry today?<sup><a href="http://www.harrisinteractive.com/news/newsletters/healthnews/HI_HealthCareNews2006Vol6_Iss08.pdf">6</a></sup> The answer appears to lie in its reliance on a distinctive model of marketing. The mainstay of the marketing effort has been a combination of advertisements to physicians, direct visits to physicians by pharmaceutical sales representatives, and a variety of gifts to physicians and their institutions, supplemented only recently by direct-to-consumer advertising. This approach must have been effective, given the size of the marketing budgets of most manufacturers, but it has also raised persistent issues about conflicts of interest from both legal and ethical points of view.<sup><a href="http://jama.ama-assn.org/cgi/content/abstract/295/4/429?ijkey=d4f4623119bcca237dbe9a2a4d6befd22905bfeb&amp;keytype2=tf_ipsecsha">7</a></sup> (...) </p>
        <p>To be clear, for-profit industries do not share the same ethical norms to which physicians and other health care professionals must adhere. Their primary commitment is to create shareholder value, not maintain an altruistic commitment to patients. But at some point the leadership of the pharmaceutical industry and their boards of directors must begin to recognize that growing public and professional mistrust could substantially detract from that value. (...)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/forskning_og_ressurser.php">Forskning og ressurser (mintankesmie.no)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/interessekonflikter_bestikkelser_og_korrupsjon.php">Interessekonflikter, bestikkelser og korrupsjon (mintankesmie.no)</a>.) </p>
<p>(<strong>Anm</strong>:  Når er et synspunkt en interessekonflikt? (When is a point of view a conflict of interest?) <a href="http://www.mintankesmie.no/statlig_legemiddelkontroll.php#et_synspunkt">BMJ 2016;355:i6194 (Published 23 November 2016)</a>.)                       </p>
					  <p>(<strong>Anm</strong>:  Høyresiden har  størst mistillit til journalistikken. (…) Videre mente 63 prosent at  journalister favoriserer kilder som mener det samme som dem. (<a href="http://www.mintankesmie.no/media.php#journalister_favoriserer_kilder">aftenposten.no  13.2.2017</a>).)</p>
                      <p>(<strong>Anm</strong>:  Mina Ghabel  Lunde, journalist. Når kilder også er venner. Pressen skal unngå bindinger som skaper usikkerhet om lojalitet. Da kan  ikke journalister omgås sine kilder privat. (<a href="http://www.mintankesmie.no/media.php#nar_kilder_ogsa_er_venner">aftenposten.no  8.2.2017</a>).) </p>
          <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/gratis_lunch_legemidler_gradighetskultur_og_korrupsjon.php#ingen_gratis_lunsj">Ingen  gratis lunsj for leger: Sponsede m&aring;ltider knyttet til flere resepter (No free  lunch for docs: Sponsored meals linked to more prescriptions) (mmm-online.com  20.6.2016)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/sakkyndige_legers_integritet_partiskhet_og_habilitet.php">Sakkyndige legers integritet, partiskhet og habilitet versus l&oslash;gn i rettssalen (sakkyndighet) (mintankesmie.no)</a>.) </p>
        <h3><a name="gratis_jushjelp" id="gratis_jushjelp"></a>- &Oslash;nsker gratis jus-hjelp</h3>
        <p><a href="http://www.kampanje.com/medier/article342935.ece">&Oslash;nsker gratis jus-hjelp</a><br />
  kampanje.no 9.10.2008<br />
  Personvernkommisjonen &oslash;nsker at alle skal gratis advokathjelp dersom man er utsatt for etiske overtramp fra pressen. </p>
        <p> I lys av saken mellom finansmannen &Oslash;ystein Strand Spetalen og Dagbladet, har Personvernkommisjonen kommet til at de &oslash;nsker at alle skal f&aring; mulighet til gratis advokathjelp mot pressen, dersom man er utsatt for etiske overtramp.</p>
        <p>Det skriver VG i dag. </p>
        <p> - Det er ikke tilfeldig at det er Spetalen som g&aring;r til sak mot Dagbladet. Han har pengene. Det er en trussel mot rettssikkerheten at de med d&aring;rlig r&aring;d sjelden g&aring;r til s&oslash;ksm&aring;l mot pressen, sier Gisle Hannemyr, som er sekret&aelig;r i Personvernkommisjonen til VG. </p>
        <p> Kommisjonen har siden mai i fjor arbeidet med en rapport p&aring; oppdrag fra regjeringen. Rapporten skal blant annet se p&aring; utfordringene for personvernet i ulike sektorer som mediesektoren. </p>
        <p> - Pressens Faglige Utvalg (PFU) er pressens eget organ og kan ikke anses for &aring; v&aelig;re like upartisk i alle sammenhenger. Det m&aring; bli lettere for vanlige folk &aring; ta saken sin inn for domstolene, sier Hannemyr til VG. </p>
        <p> Generalsekret&aelig;r Per Edgar Kokkvold i Norsk Presseforbund st&oslash;tter forslaget. (...) </p>
        <h3>- Rettssikkerheten undergraves</h3>
        <p><a name="rettssikkerheten_undergraves" id="rettssikkerheten_undergraves"></a><a href="http://www.aftenposten.no/meninger/debatt/article2165290.ece">Rettssikkerheten undergraves</a><br />
EINAR PLYHN, Forlagssjef <br />
aftenposten.no 23.12.2007<br />
Psykiatridebatt. Norsk psykiatri krenker mange pasienter. De f&aring; som orker &aring; klage, m&oslash;ter mye motstand. La meg kort omtale to av motstandsregimene som undergraver rettssikkerheten innen psykiatrien. (...)</p>
        <p>Det er selvsagt ikke tilfeldig at nettopp de sidene som vedr&oslash;rer min klage manglet. Ullev&aring;l fortsetter slik &aring; krenke min lovfestede rett til fullt innsyn i journalen. Men selv ledelsen p&aring; Ullev&aring;l synes &aring; mene at s&aring;pass m&aring; jeg t&aring;le.</p>
        <p> Dessverre hjalp det ikke &aring; l&oslash;fte saken opp til Helsetilsynet. Tilsynet vegret seg nemlig for &aring; g&aring; inn i klagen, f&oslash;r det plutselig slo fast at brevet med den krenkende diagnosen rett og slett var &quot;faglig argumentering&quot;. (...)</p>
        <p><strong>Fullstendig rettsl&oslash;s. </strong><br />
  N&aring;r behandlingssted og helsetilsyn legger seg til i samme seng, er det ikke mulig for noen &aring; vinne frem med en klage. Men det er sv&aelig;rt alvorlig n&aring;r klagebehandlingen etterlater klagerne med opplevelsen av &aring; v&aelig;re fullstendig rettsl&oslash;se. </p>
        <p> Hvorfor tar ingen ansvar for rettssikkerheten i psykiatrien? (...)</p>
        <h3>- Svenska patienter är i dag rättslösa</h3>
        <p><a href="http://www.dagensmedicin.se/debatt/debattsvenska-patienter-ar-i-dag-rattslosa/?utm_source=apsis-anp-3&amp;utm_medium=nyhetsbrev%20-%20DM&amp;utm_content=unspecified&amp;utm_campaign=unspecified">”Svenska patienter är i dag rättslösa”</a><br />
dagensmedicin.se 3.2.2014<br />
Det nya systemet värnar om personalen, men gör patienter och anhöriga rättslösa, skriver juristen Dennis Brinkeback.</p>
        <p> ”Jag tänker anmäla läkaren eller sjukvården så att detta inte händer någon annan”. Så avslutas ofta de ständigt återkommande artiklarna om vårdskador. Det är en god tanke av patienter och anhöriga att de tänker så. Men tyvärr har en anmälan ingen betydelse eller bara marginell betydelse.</p>
        <p>Enligt Socialstyrelsens beräkningar skadas varje år ungefär 105 000 patienter i Sverige. Av dessa får cirka 10 000 bestående men och 3000 dör. Skadorna genererar mer än 600 000 extra dagar på sjukhus.</p>
        <p> Hur ska man då komma förebygga och förhindra detta enorma antal årliga vårdskador? Ja, den nuvarande socialministern under ledning av socialminister Göran Hägglund har från den 1 januari 2011 infört en patientsäkerhetslag(2010: 659), vilket har medfört att vi som enda land i världen tagit bort det vårdrättsliga disciplinansvaret. (...) </p>
        <h3>Diverse artikler</h3>
        <p><a href="http://www.digi.no/926656/ip-adresse-ikke-fellende-bevis">– IP-adresse ikke fellende bevis</a><br />
          digi.no 24.1.2014<br />
          Dommer avviser filmselskaps piratsøkmål.</p>
        <p>En føderal dommer ved distriktsdomstolen i Seattle i USA har godkjent en begjæring om å avvise et søksmål i et tilfelle av ulovlig deling av filmen «Elf-Man» via en BitTorrent-tjeneste. Dette skriver <a href="http://torrentfreak.com/judge-ip-address-does-not-prove-copyright-infringement-140121/">TorrentFreak</a>.</p>
        <p>I fjor vår saksøkte skaperne av filmen, som er organisert gjennom selskapet Elf-Man LLC, 152 personer som på dette tidspunktet ikke var kjente for selskapet. Derimot hadde selskapet registrert et tilsvarende antall IP-adresser og ba retten om å få lov til å innhente tilstrekkelig informasjon til å identifisere «eierne» av hver IP-adresse. Dette ble innvilget, men med en advarsel om at «identifisering av kontoeieren forteller veldig lite om hvem som faktisk lastet ned Elf-Man ved å bruke denne IP-adressen». <a href="http://www.scribd.com/doc/201180332/ORDER-Granting-Motion-to-Dismiss">Dette skriver dommer Robert S. Lasnik</a>.</p>
        <p>Rettighetshaverne har etter alt å dømme ikke greid å skaffe flere bevis i saken, men har likevel valgt å fortsette ved å hevde at de saksøkte personene enten har lastet ned BitTorrent-applikasjonen og brukt den til å laste ned og dele opphavsrettsbeskyttet materiale, eller har tillatt, bidratt til eller oppfordret andre til bruk av deres Internett-forbindelse til å laste ned og dele opphavsrettsbeskyttet materiale. </p>
        <p>Dommeren skriver i kjennelsen at det ikke har blitt lagt fram noen annet bevis enn IP-adressene i spørsmålet om kontoeierne har lastet og/eller delt filmen. Ifølge kjennelsen kan det like gjerne ha vært et familiemedlem, en gjest eller en «gratispassasjer» som har deltatt i BitTorrent-svermen. (...) </p>
        <p>Kjennelsen betyr altså at det amerikanske rettsvesenet, i alle fall så langt, mener at en IP-adresse ikke er nok til å avgjøre hvem som har bedrevet eller bidratt til piratkopiering. Men også at en eier av et Internett-abonnement ikke er juridisk ansvarlig for hva andre måtte bruke Internett-forbindelsen til. </p>
        <p>En juridisk, men temmelig partisk analyse av hva kjennelsen betyr, <a href="http://fightcopyrighttrolls.com/2014/01/18/big-news-judge-rules-that-the-trolls-complaint-does-not-meet-pleading-standards/">finnes her</a>. (...) </p>
        <p><a href="http://www.dagensmedicin.se/nyheter/quick-fallet-utreds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br />
cannot generate system identifier for general entity "utm_medium"
Line: 4992, Col: 101
…fallet-utreds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_conte…
reference not terminated by REFC delimiter
Line: 4992, Col: 111
…eds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspeci…
reference to external entity in attribute value
Line: 4992, Col: 111
…eds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspeci…
cannot generate system identifier for general entity "utm_content"
Line: 4992, Col: 132
…-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=uns…
reference not terminated by REFC delimiter
Line: 4992, Col: 143
…medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Q…
reference to external entity in attribute value
Line: 4992, Col: 143
…medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Q…
reference not terminated by REFC delimiter
Line: 4992, Col: 168
…M&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br…
reference to external entity in attribute value
Line: 4992, Col: 168
…M&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br…
general entity "utm_medium" not defined and no default entity
Line: 4992, Col: 101
…fallet-utreds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_conte…
reference to entity "utm_medium" for which no system identifier could be generated
Line: 4992, Col: 111
…eds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspeci…
general entity "utm_content" not defined and no default entity
Line: 4992, Col: 132
…-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=uns…
reference to entity "utm_content" for which no system identifier could be generated
Line: 4992, Col: 143
…medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Q…
reference to entity "utm_campaign" for which no system identifier could be generated
Line: 4992, Col: 168
…M&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br…
            dagensmedicin.se 28.11.2013<br />
            Regeringen har i dag beslutat att en särskild utredare ska granska vårdens och rättsväsendets agerande i fallet Thomas Quick.</p>
        <p> Utredaren ska ”granska och redovisa ” agerandet samt i ett andra steg analysera ”om det har förekommit strukturella brister i rättsväsendets och vårdens agerande” i samband med de brottsmålsprocesser där Sture Bergwall, tidigare Thomas Quick, dömdes för åtta mord som han senare blivit frikänd för, uppger regeringen på sin hemsida.</p>
        <p> Uppdraget omfattar även sakkunnigas och advokaters agerande.</p>
        <p> Särskild utredare blir professor emeritus Daniel Tarschys, som till sin hjälp får professor emeritus Kjell Asplund, lagmannen Mari Hedenborg, professor Petter Asp, rättssakkunnige Mikael Kullberg och den norske specialrådgivaren Tor Langbach.</p>
        <p> Uppdraget ska redovisas senast den 29 januari 2015. (...)        </p>
        <p>(<strong>Anm</strong>:  <a href="http://www.nrk.no/norge/far-rapport-om-quick-gransking-1.12604174">Får  rapport om Quick-gransking. En arbeidsgruppe har forsøkt å finne ut hvordan  Sture Bergwall, tidligere kjent som Thomas Quick, kunne bli dømt for drap han  senere ble frikjent for. I dag mottar Riksadvokaten en rapport om norske  myndigheters innsats. (nrk.no 15.10.2015)</a>.)</p>
					  <p>(<strong>Anm</strong>:  <a href="http://www.nrk.no/norge/mener-etterforskerne-sa-bort-fra-tidligere-bevis-1.12604174">Mener  etterforskerne så bort fra tidligere bevis. Arbeidsgruppen som har gransket  norsk politi og påtalemyndigheters arbeid i sakene mot Sture Bergwall, også  kjent som Thomas Quick, mener de ikke var kritiske nok, overså flere beviser og  ble farget av den svenske etterforskningen. (nrk.no 15.10.2015)</a>.)</p>
					  <p>(<strong>Anm</strong>:  <a href="http://www.aftenposten.no/nyheter/iriks/Ny-rapport-Norsk-politi-var-ikke-kritisk-nok-i-Quick-sakene-8203826.html">Ny  rapport: Norsk politi var ikke kritisk nok i Quick-sakene. (…) Fungerende  riksadvokat Knut Erik Sæther mottok rapporten klokken 12 i dag.  Arbeidsgruppen konkluderer med at norsk  politi og påtalemyndighet ikke var kritiske nok i etterforskningen av Sture  Bergwall. (…)Gruppen har også gitt en vurdering av om politi og påtalemyndighet  i Norge var kritiske nok til etterforskningen og de tilståelse Berwall kom med.  En granskingskommisjon i Sverige har kommet med sterk kritikk av politi, påtalemyndighet,  helsevesenet og av domstolene. (aftenposten.no 15.10.2015)</a>.)<strong> </strong></p>
<p><a href="rhttp://www.retriever-info.com/no/">Kunsten å tenke riktig</a> <br />
          aftenposten.no 11.7.2013<br />
          Bok utenfra</p>
        <p>Den viktigste grunnen til menneskenes          suksess er at vi har en evne som          andre arter kun har i små 
            porsjoner: evnen til å tenke.
            å tenke riktig<br />
            <br />
            Denise D. Cummings Good Thinking
            Som andre verktøy må tanken også
            brukes presist, ellers kan den gjøre
            mer skade enn nytte.
            Men vi utnytter denne evnen
            dårlig, og den kommer ikke av
            seg selv: Den må utvikles, og det
            er visse måter å bruke den på
            som er bedre enn andre. Den
            alvorligste mangelen i norsk
            skole er kanskje ikke mangel
            på kunnskap, men at elevene
            ikke får lært seg gode måter å
            tenke på.<br />
            <br />
            Da tenker jeg ikke bare på
            Aristoteles’ syllogismer, som
            Erasmus Montanus brukte til
            å «bevise» at Mor Nille var en
            sten. De kan være nyttige, der
            de passer, men tenkning er så
            mye mer enn dette. Og spesielt
            de siste tiårene har psykologer,
            filosofer og andre utviklet verktøyer
            vi kan bruke for å tenke
            bedre.<br />
            <br />
            En slik fornyet «verktøykiste»
            gir filosofen Denise Cummins
            oss i Good Thinking. Noen av
            verktøyene er gamle, som Aristoteles’
            logikk, og den litt mindre
            kjente metoden som presten
            Thomas Bayes (1702 – 1761)
            utviklet for å beregne sannsynlighet:
            Bayes’ regel. (...)        </p>
        <p><a href="http://www.retriever-info.com/no/">          Er det mulig å forbli uberørt?</a><br />
          Pål Behrens - leder, Advokatforeningen Oslo krets<br />
          aftenposten.no 10.6.2013<br />Åpenhet. Den nye medievirkeligheten kan være en fare for rettssikkerheten.</p>
        <p>Mediene viser en enorm interesse
          for visse rettssaker. Nettredaksjoner
          formidler tidvis hvert ord aktørene
          sier, profilerte strafferettsadvokater
          og annen ekspertise gir fortløpende
          kommentarer i alle kanaler, og
          det hele suppleres av en strøm med
          refleksjoner og synspunkter i sosiale
          medier. Er det mulig for rettens
          aktører å forbli uberørt? Er det behov
          for nye regler om offentlighet i
          rettspleien?</p>
        <p>I Norden er det generell åpenhet
          omkring den rettslige prosessen.
          Med mindre det blir gjort spesifikke
          unntak, kan det grovt sett refereres
          fra rettsmøtet.</p>
        <p>Åpenheten gjør allmennheten
          trygg på at rettsprosessen er forsvarlig
          og er i utgangspunktet et
          gode for tiltalte i straffesaker. (...) </p>
        <p><a href="http://tidsskriftet.no/article/2125128">Kunnskap om kunnskapen</a><br />
Tidsskr Nor Legeforen 2011; 131:1540 (23.8.2011)<br />
Torgeir Bruun Wyller går i Tidsskriftet nr. 12/2011 til felts mot det han betegner som «vulgærcochranisme» (1). Han presenterer en original variant av «evidenspyramiden», hvor elektronisk beslutningsstøtte og retningslinjer blandes med nivåene for å gradere kvaliteten på faglig dokumentasjon. Han skriver: «Ved medisinsk embetseksamen i Oslo har det sågar vært foreslått at studentene skal kunne gjengi pyramidens nivåer og det tilhørende nummereringssystemet for rangering av evidens.» Vi stiller oss spørrende til Wyllers antydning om at undervisning i kunnskapshåndtering er uttrykk for «vulgærcochranisme». (...)</p>
        <p>Nivåene for å gradere faglig dokumentasjon er noe studentene møter alt som ferske leger. Eksempelvis er den nye nasjonale retningslinjen om behandling og rehabilitering ved hjerneslag basert på en slik gradering (3). Kunnskap om kunnskapen er en forutsetning for at medisinstudenter skal kunne ha et selvstendig, kritisk og reflektert forhold til kunnskapsgrunnlaget i eget fag. Etter å ha gjennomført seks års universitetsstudier i medisin bør en student kunne gjøre rede for etablerte nivåer for å gradere kvaliteten på faglig dokumentasjon. (...) </p>
        <p><a href="http://www.itavisen.no/874962/lurte-verden-trill-rundt">Lurte verden trill rundt</a><br />
itavisen.no 3.8.2011<br />
IE-historie var bare tull.</p>
        <p> Mandag skrev vi en <a href="http://www.itavisen.no/874806/ie-brukere-er-dummere-enn-andre">artikkel</a> om en undersøkelse som angivelig skulle vise at IE-brukere er dummere enn brukere av andre nettlesere.</p>
        <p><strong>BBC gikk på limpinnen</strong><br />
  Saken stammet opprinnelig fra BBC, som vanligvis er en etterrettelig kilde.</p>
        <p>Nå viser det seg at både BBC, vi og så godt som resten av verden gikk rett på limpinnen. Historien er rett og slett oppspinn, diktet opp av folk som ga seg ut for å representere et seriøst analysebyrå og som la mye tid og arbeid ned i å få spøken til å se troverdig ut.</p>
        <p><strong>Falsk nettside</strong><br />
  Lurendreierne gikk så langt som til å sette op en falsk nettside med bilder og layout kopiert fra en legitim, fransk nettside.</p>
        <p>Det falske kanadiske selskapet AptiQuant Psychometric Consulting forsynte til overmål BBC med en mengde data som tilynelatende så tilforlatelige ut.</p>
        <p>Sjekket ikke godt nok<br />
  BBC skal ha brukt lang tid på å grave fram saken, og journalisten skal også ha sjekket med uavhengige kilder før saken ble lagt ut.</p>
        <p>Den fikk stor publisitet flere steder på nettet, ble twittret og retwittret i stort monn og ble også sitert på radio og TV i store deler av verden.</p>
        <p><strong>Skriver om søksmål</strong><br />
  Aptiquant skriver nå på sin nettside at de har blitt truet med søksmål fra IE-brukere. Det er trolig også en fiktiv sak.</p>
        <p>BBC <a href="http://www.bbc.co.uk/news/technology-14389430">beklager</a> i dag saken. Det samme gjør vi. (...) </p>
        <p><a href="http://www.law.com/jsp/cc/PubArticleCC.jsp?id=1202497750428">Crossing the Line: The Trial of GlaxoSmithKline Lawyer Lauren Stevens</a><br />
law.com 23.6.2011 <br />
When the U.S. Department of Justice charged former in-house lawyer Lauren Stevens with six felonies, it aimed to send a clear message that no one should lie to federal investigators—including lawyers. But the short and bitter trial that followed backfired. In the end it conveyed a message to both in-house counsel and prosecutors about the dangers of overzealousness. </p>
        <p>On May 10, in a move that was as sudden as it was dramatic, a federal district court judge in midtrial acquitted the former in-house counsel at GlaxoSmithKline of all six counts. While Stevens and her lawyers celebrated with champagne, sources say the stunned prosecutors privately complained that the jury would have found Stevens guilty had the judge let the trial continue. (...) </p>
        <p><a href="http://www.dagbladet.no/2011/05/04/kultur/tekno/fildeling/porno/internett/16410741/">- En ip-adresse er ikke det samme som en person</a><br />
          dagbladet.no 4.5.2011<br />
          Amerikansk dommer bremser pornopiratjegere. </p>
        <p>En fersk amerikansk rettsavgjørelse sår nå tvil om hvor tungt ip-adresser veier som bevis for ulovlig fildeling, melder <a href="http://torrentfreak.com/ip-address-not-a-person-bittorrent-case-judge-says-110503/">Torrentfreak.com</a>.</p>
        <p>I avgjørelsen fra dommer Harold Baker ved tingretten i Illinois er nå en opphavsrettseier - i dette tilfellet en kanadisk pornoprodusent - nektet å sende ut stevninger basert på ip-adresser.</p>
        <p>Avgjørelsen begrunnes med at en ip-adresse ikke er det samme som en person, og at flere individer kan skjule seg bak en slik adresse. (...)        </p>
        <p><a href="http://www.bloomberg.com/news/2011-04-27/ex-glaxo-lawyer-went-too-far-u-s-says-at-opening-of-obstruction-trial.html">Ex-Glaxo Lawyer `Went Too Far,’ U.S Says at Opening of Obstruction Trial</a><br />
bloomberg.com 27.4.2011<br />
An ex-GlaxoSmithKline Plc (GSK) attorney accused of covering up the company’s improper marketing of its antidepressant drug Wellbutrin SR is a “lawyer who went too far,” a federal prosecutor said as her trial began. </p>
        <p> Lauren Stevens, former vice president and associate general counsel for London-based Glaxo, is charged with impeding an inquiry in 2002 and 2003 by the U.S. Food and Drug Administration into the marketing of the drug for uses not approved by the FDA. </p>
        <p> “This is a case about a lawyer who put loyalty to her company above fidelity to the truth and to the law,” said Patrick Jasperse, a Justice Department lawyer, during opening statements today in Greenbelt, Maryland, federal court. “This is a case about a lawyer who went too far, from aggressively representing her company to breaking the law.” (...) </p>
        <p><a href="http://nyheter.uib.no/?modus=vis_nyhet&amp;id=48465">Hjernen er ikke lenger alene</a><br />
uib.no 16.3.2011<br />
Hjerneforskere og samfunnsvitere møtes til internasjonal workshop i Bergen for å bygge bro mellom hjernen og samfunnet.</p>
        <p>Hvis det blir mulig å skanne hjernen og få kjennskap til hvordan den fungerer, vil det også ha etiske konsekvenser ved f eks diagnostisering og kanskje også i sammenheng med juridiske spørsmål.</p>
        <p>– Det er samfunnsforskerne som sitter med en kritisk kompetanse og kan behandle de etiske spørsmålene som er knyttet til denne forskningen, sier professor Kenneth Hugdahl ved institutt for biologisk og medisinsk biologi.</p>
        <p>Denne uken møtes stipendiater og postdoktorer på Bergen Neuroschool for å få en innføring i hjerneskanningsmetoden fMRI. Workshopen arrangeres av European Neuroscience and Society Network og fMRI-gruppen i Bergen.</p>
        <p>– Det unike med denne workshopen her er at halvparten av stipendiatene er samfunnsvitere og den andre halvparten er hjerneforskere, sier Hugdahl. (...) </p>
        <p>(<strong>Anm</strong>:  <span dir="auto"><em>Funksjonell magnetresonanstomografi</em></span> (fMRI; Functional magnetic resonance imaging) (<a href="http://en.wikipedia.org/wiki/Functional_magnetic_resonance_imaging">no.wikipedia.org</a>).)</p>
value of attribute "dir" cannot be "auto"; must be one of "ltr", "rtl"
Line: 5111, Col: 51
…<strong>Anm</strong>: <span dir="auto"><em>Funksjonell magnetresonanstomograf…
        <p><a href="http://jama.ama-assn.org/content/305/11/1134.full?etoc">Statistical Association and Causation</a><br />
JAMA. 2011;305(11):1134-1135 (16 March) <br />
Advances in medical knowledge proceed on several fronts, optimally simultaneously. Each discipline provides unique, relevant, and complementary information to a totality of evidence. When the totality of evidence is sufficient, health care professionals can make the most rational decisions for individual patients and policy makers can make the most rational decisions for the health of the general public.<sup>1</sup>​ When the totality of evidence is incomplete, it is appropriate to remain uncertain.<sup>2</sup> Nonetheless, health care professionals and policy makers are always faced with decision making. Although medical researchers are likely to be familiar with these concepts, this commentary is primarily for clinicians and policy makers to increase their knowledge and understanding of the unique contributions of different types of evidence to the conclusion of a valid statistical association as well as the need to evaluate the totality of evidence to judge causality. (...) </p>
        <p><a name="vitenskap_eller" id="vitenskap_eller"></a><a href="http://www.morgenbladet.no/apps/pbcs.dll/article?AID=/20110311/OSPALTISTER/703119987/-1/SPALTISTER">Vitenskap eller</a><a href="http://www.morgenbladet.no/apps/pbcs.dll/article?AID=/20110311/OSPALTISTER/703119987/-1/SPALTISTER"> intuisjon?</a><br />
          Hans Petter Graver er jurist og dekan ved Det juridiske fakultet ved Universitetet i Oslo<br />
          morgenbladet.no 11.3.2011<br />
          En ny avhandling viser hvordan bevisvurderinger i Norge lider av teorifattigdom og bygger på grunnforutsetninger som ikke holder for en nærmere analyse. (...)</p>
        <p>Er det et sted vitenskapen ennå ikke har fått innpass i samfunnet, så er det i bevisvurderingen i norsk rett. Skummelt? Det kommer an på hva du stoler mest på: Vitenskapen eller intuisjonen.</p>
        <p>Etter etablert oppfatning skal dommeren legge det mest sannsynlige faktum til grunn. Det gjelder også der det bare er 51 prosent sannsynlig. Selv om risikoen for feil er ganske stor i slike tilfeller, blir det i det lange løp færrest feil ved domstolene om dommere konsekvent dømmer etter en slik sannsynlighetsregel. Eller blir det det? (...) </p>
        <p><strong>Bevisvurdering</strong> (...) Magne Strandberg har skrevet en doktoravhandling som er det første større bevisteoretiske arbeid i Norge på generasjoner. Hva: Avhandlingen viser hvordan bevisvurderinger i Norge lider av teorifattigdom og bygger på grunnforutsetninger som ikke holder for en nærmere analyse. Hvem er for og hvem er mot: Avhandlingen utfordrer den tradisjonelle læren om at bare dommere bygger på det mest sannsynlige, så får vi flest riktige dommer. Den viser også at vi ikke kan utvikle metoder for å eliminere usikkerheten om faktum, men vi kan gjøre dommeres vurderinger mer robuste. Betydning: Norske domstoler kan få styrket sitt teoretiske fundament for sine vurderinger av bevis. (...)</p>
        <p>Håndtering av usikkerhet er ikke spørsmål om tro, men om de hensyn som ligger bak reglene. Og hensynene er forskjellige bak forskjellige regler. Vern av uskyldige ligger bak straffeprosessen, forbrukerbeskyttelse ligger bak forbrukerkjøpsreglene, føre-var prinsippet bak forurensningsreglene et cetera. </p>
        <p>Det er med andre ord et sprik mellom juristenes selvforståelse og deres praksis når det gjelder håndtering av bevis. De lærer og sier at de skal se etter hva som er mest sannsynlig, og legge det til grunn for dommen. Men hva dette betyr, og hvordan det kan skje i praksis finnes det lite refleksjon rundt. I praksis bedømmes bevisene ut fra risikoen for å ta feil og hva slags håndtering av denne risikoen som er mest i samsvar med de rettsreglene det er aktuelt å anvende. </p>
        <p>Men disse bedømmelsene må dommerne foreta helt uten veiledning fra rettsvitenskapen. Først nå i den aller seneste tid har rettsforskningen begynt å ta fatt i dette og gi det en vitenskapelig bearbeiding. (...) 
        </p>
        <p><a href="http://www.aftenposten.no/meninger/debatt/article4051643.ece">Oldemors store hemmelighet</a><br />
          ULF NESTVOLD - sykepleier og filosof, Oslo <br />
          aftenposten.no 6.3.2011<br />
          NRK har gjennom programserien Hvem tror du at du er? gitt oss glimt av slektsgranskning, både av «fine» og litt mindre «fine» slekter og familier.</p>
        <p> Midt under sending av et av disse programmene, kom jeg til å tenke på en dansk undersøkelse jeg hørte om for lenge siden: Man ville se om det fantes genetiske årsaker til schizofreni. Man gentestet pasienten, moren og den som ble oppgitt som far, vanligvis morens ektefelle. Etter forholdsvis kort tid ble undersøkelsen avsluttet i all stillhet, fordi det svært ofte viste seg at den som ble oppgitt å være pasientens far, umulig kunne være det.</p>
        <p> Når man vet at ens rike, mektige og berømte aner på mannssiden ofte giftet seg i moden alder med langt yngre piker, at de dessuten ofte var ute på lange reiser, at det i tjenerstaben kunne befinne seg kjekke, unge menn..</p>
        <p>            I jødisk kultur og tradisjon har man skjønt et vesentlig poeng: Du er jøde hvis din mor er jøde. I denne sammenhengen nevnes ikke faren. </p>
        <p> Nå vel. Det er allikevel de rike, berømte og mektige forfedre man bærer navn etter og er stolt av. Mødrene regnes vanligvis ikke med. Og selv om disse anene ikke sier noe viktig om hvem man er, bare hvem man tror man er, så er programmene interessante. Og meget underholdende. (...)        </p>
        <p><a href="http://onlinelibrary.wiley.com/doi/10.1111/j.1468-2230.2011.00848.x/abstract">Sentencing Derrida</a><br />
Simon Glendinning<br />
The Modern Law Review 2011;74(2): 306–321 (March) (...) </p>
        <p><a href="http://www.bmj.com/content/342/bmj.d1292.full">Vaccine manufacturers cannot be sued over design defects, US Supreme Court rules</a><br />
BMJ 2011; 342:d1292 (25 February) <br />
The US Supreme Court has ruled by a 6-2 majority that vaccine manufacturers cannot be sued over claims of design defects in their products. </p>
        <p> The court was ruling on a case brought by the parents of a child who developed seizures after a routine diphtheria-pertussis-tetanus (DPT) vaccination (Bruesewitz v Wyeth Inc). It ruled that an act passed by Congress in 1986, which set up a no fault scheme to compensate any child injured by vaccine side effects, bars lawsuits against vaccine manufacturers. (...) </p>
        <p><a name="ein_person" id="ein_person"></a><a href="http://nrkbeta.no/2011/02/15/%c2%abei-ip-adresse-er-ikkje-ein-person%c2%bb/?utm_source=feedburner&amp;utm_medium=email&amp;utm_campaign=Feed%3A+nrkbeta+%28NRKbeta%29">«Ei IP-adresse er ikkje ein person</a><a href="http://nrkbeta.no/2011/02/15/%c2%abei-ip-adresse-er-ikkje-ein-person%c2%bb/?utm_source=feedburner&amp;utm_medium=email&amp;utm_campaign=Feed%3A+nrkbeta+%28NRKbeta%29">»</a><br />
nrkbeta.no 15.2.2011<br />
Dei siste åra har vi sett fleire rettssakar rundt ulovleg nedlasting av innhald. I fleire av desse rettssakane verkar det som om rettsvesenet er overbevist om at ei IP-adresse kan kartleggjast direkte tilbake til ein person.</p>
        <p>Storbrittania har hatt ei heil mengd slike rettssakar i det siste, og no har ein dommar endeleg konkludert med at <strong>ei IP-adresse er ikkje ein person</strong>. Det er <a href="http://arstechnica.com/">ArsTechnica</a> som kan rapportere om denne heldige konklusjonen i ein <a href="http://arstechnica.com/tech-policy/news/2011/02/court-confirms-ip-addresses-arent-people-and-p2p-lawyers-know-it.ars">nyleg rettssak relatert til pornografi</a>.</p>
        <p><a href="http://www.dontdisconnect.us/">Don't Disconnect Us</a> fekk i fjor produsert ein video som vi i NRKbeta syns oppsummerer problemstillinga veldig fint: (...) </p>
        <p><a href="http://www.nrk.no/nyheter/kultur/1.6932398">Krimdokumentar p&aring; NRK 1 <br />
          Slik ble Fritz Moen renvasket</a><br />
          nrk.no 5.1.2010<br />
          Dokumentaren &quot;Sannhetsjegeren&quot; innholder videobevisene som bidro til &aring; rulle opp Norgeshistoriens alvorligste justismord. Privatetterforsker Tore Sanberg renvasket Fritz Moen ved hjelp av rekonstruksjoner. (...)        </p>
        <p><a name="hvordan_unnga" id="hvordan_unnga"></a><a href="http://nyheter.uib.no/?modus=vis_nyhet&amp;id=44694">Hvordan unng&aring;</a><a href="http://nyheter.uib.no/?modus=vis_nyhet&amp;id=44694"> justismord</a><br />
uib.no 9.10.2009<br />
(...) I en demokratisk stat som Norge er det sv&aelig;rt viktig at folket har tiltro til rettsvesenet og politiet, og at de utf&oslash;rer arbeidet sitt p&aring; riktig m&aring;te. Likevel viser historien at justismordene fortsetter &aring; skje, og b&aring;de <a href="http://no.wikipedia.org/wiki/Liland-saken">Per Liland</a> og <a href="http://www.foodconsumer.org/newsite/Non-food/Disease/virus_linked_to_chronic_fatigue_syndrome.html">Fritz Moen</a> har sittet mange &aring;r bak murene p&aring; tross av at de var uskyldige.</p>
        <p> Hva var det egentlig som skjedde?</p>
        <p>&ndash; Det er ikke mulig &aring; svare p&aring; n&oslash;yaktig hva som skjer n&aring;r et justismord finner sted, men vi har funnet mange mekanismer som medvirker til det, forteller Bj&oslash;rn C. Ekeland. (...)</p>
        <p><strong><a name="sprakets_forsvinning" id="sprakets_forsvinning"></a>Spr&aring;kets forsvinning</strong><br />
        &ndash; Et omfattende problem er det jeg kaller spr&aring;kets forsvinning. Det handler om at det juridiske spr&aring;ket er utilgjengelig for folk flest, men ogs&aring; hvordan dommeren tar i bruk spr&aring;ket, og at stemmer ikke blir h&oslash;rt, forklarer Ekeland. </p>
        <p> Han mener dommeren i enkelte tilfeller kan bidra til &aring; mystifisere argumenter som er f&oslash;rt i saken. Det skjer ogs&aring; at vesentlige stemmer som kunne ha endret utfallet av en sak, blir fortiet.</p>
        <p>&ndash; S&aring;kalte &rdquo;<a href="http://no.wikipedia.org/wiki/0-dokument">nulldokumenter</a>&rdquo; er unntatt partsinnsyn i rettssaker. Dette er dokumenter Kripos vurderer som uvesentlige, og som ikke inng&aring;r i sakspapirene. I Fritz Moen-saken l&aring; det, som Tore Sandberg har p&aring;pekt, viktige beviser i disse dokumentene, sier Ekeland. (...)        </p>
        <p><a href="http://www.aftenposten.no/nyheter/uriks/article3094723.ece">Eva Joly: - Silvio Berlusconi er farlig</a><br />
          aftenposten.no 27.5.2009<br />
          Eva Joly sikter etter plass i EU-parlamentet s&aring; hun kan arbeide for &aring; bedre de europeiske rettssystemene. (...)</p>
        <p>- Silvio Berlusconi er farlig, og Nicolas Sarkozy har autorit&aelig;re trekk, sier den ber&oslash;mte norsk-franske juristen og korrupsjonsjegeren Eva Joly om henholdvis Italias statsminister og Frankrikes president. Begge holder et stramt grep om mediene og har g&aring;tt til harde utfall mot dommerstanden. (...) </p>
        <p>Europa kan ikke fungere med to dysfunksjonelle land, nemlig Frankrike og Italia n&aring;r det gjelder rettsvesenet. (...)</p>
        <p>- Jeg synes ikke at jeg har noe valg. Jeg synes noen m&aring; si dette, noen m&aring; arbeide for at de europeiske rettssystemene blir bedre. Europa kan ikke fungere med to dysfunksjonelle land, nemlig Frankrike og Italia n&aring;r det gjelder rettsvesenet. Det er farlig for oss at de to demokratiene ikke fungerer, sier Joly til den danske avisen <a href="http://www.berlingske.dk/article/20090526/epvalg/705260087/">Berlingske Tidendes nettutgave</a>. Hun viser til at Sarkozy har lovet &aring; avskaffe landets rundt 600 s&aring;kalte forh&oslash;rsdommere innen &aring;rets utgang. (...)        </p>
        <p>(<strong>Anm</strong>:  <a href="http://www.aftenposten.no/nyheter/uriks/Berlusconi-domt-til-tre-ars-fengsel-8087951.html">Berlusconi  dømt til tre års fengsel. Italias tidligere statsminister Silvio Berlusconi er  dømt til tre års fengsel for korrupsjon. (nrk.no 8.7.2015)</a>.)</p>
<p><a name="falske_forteljingar" id="falske_forteljingar"></a><a href="http://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f&oslash;lgjer <br />
cannot generate system identifier for general entity "id"
Line: 5166, Col: 111
…ttp://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale…
reference not terminated by REFC delimiter
Line: 5166, Col: 113
…p://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f…
reference to external entity in attribute value
Line: 5166, Col: 113
…p://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f…
general entity "id" not defined and no default entity
Line: 5166, Col: 111
…ttp://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale…
reference to entity "id" for which no system identifier could be generated
Line: 5166, Col: 113
…p://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f…
        </a>Uib.no 21.4.2009<br />
        Einkvar dom i ein rettssal er basert p&aring; ei forteljing. Kva som f&oslash;rer til falske forteljingar og justismord, vil litteraturprofessor Arild Linneberg finne ut av. </p>
        <p>          Eit av dei mest kjente justismorda som har skjedd i Noreg er saka mot Fritz Moen. Han vart d&oslash;md for to drap og sona mange &aring;r i fengsel, heile tida medan han hevda seg uskuldig. I saka mot Moen vart ei rekke bevis og indisium oversett og omg&aring;tt for &aring; konstruere historia om drapa slik at Moen var drapsmannen. Til d&oslash;mes vart tidspunktet for det eine d&oslash;dsfallet flytta, slik at det passa med eit tidspunkt d&aring; han ikkje hadde alibi. At blodtypen som vart funnen p&aring; offeret heller ikkje stemte med Fritz Moen sin, vart oversett. Ved fleire h&oslash;ve mistolka d&oslash;vetolkane kva den d&oslash;ve Moen sa i retten og i avh&oslash;yr. F&oslash;rst n&aring;r ein annan mann seinare innr&oslash;mte p&aring; d&oslash;dsleie at han var gjerningsmannen, vart Moen frikjend. (...)        </p>
        <p><a href="http://www.nytimes.com/2009/03/05/washington/05scotus.html?th&amp;emc=th">Drug Approval Is No Legal Shield, Justices Rule</a> (<span class="color_lightgreen">Legemiddelgodkjenning er ikke rettslig skjold mot s&oslash;ksm&aring;l, if&oslash;lge domstolkjennelse</span>) <br />
nytimes.com 4.3.2009<br />
WASHINGTON &mdash; In a major setback for business groups that had hoped to build a barrier against injury lawsuits seeking billions of dollars, the <a href="pre-empt%20">Supreme Court</a> on Wednesday said state juries may award damages for harm from unsafe drugs even though their manufacturers had satisfied federal regulators. (...)</p>
        <p><a href="http://www.nrk.no/nyheter/utenriks/1.6485406">Berlusconi-advokat d&oslash;mt</a><br />
          nrk.no 17.2.2009<br />
        Den britiske advokaten David Mills er d&oslash;mt til fire og et halv &aring;rs fengsel i Milano for korrupsjon. Det er statsminister Silvio Berlusconi som skal ha betalt ham pengene.</p>
        <p> 
        Mills var Berlusconis advokat da han if&oslash;lge dommen tok imot over fire millioner kroner for &aring; vitne falsk i to rettssaker mot Berlusconi p&aring; 1990-tallet.</p>
        <p> Silvio Berlusconi var tiltalt i den samme saken, men skaffet seg immunitet. (...)        </p>
        <p><a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=56447">American Association for Justice Lists Overturning Pre-emption as One of Its Top Priorities in 2009</a><br />

          Kaisernetwork.org 14.1.2009<br />
Officials for the <a href="http://www.justice.org/">American Association for Justice</a> on Monday released a legislative agenda for 2009 and cited as their top priority efforts to pass legislation (<a href="http://thomas.loc.gov/cgi-bin/query/z?c110:S.3398:">S 3398</a>, <a href="http://thomas.loc.gov/cgi-bin/query/z?c110:H.R.6381:">HR 6381</a>) to overturn a recent U.S. Supreme Court decision that protects manufacturers of medical devices from state product liability lawsuits, CongressDaily reports. <a href="http://help.senate.gov/">Senate Health, Education, Labor and Pensions Committee</a> Chair Edward Kennedy (D-Mass.) and <a href="http://energycommerce.house.gov/">House Energy and Commerce Committee</a> Chair Henry Waxman (D-Calif.) sponsored the bills to overturn the court's ruling last year in <em>Riegel v. Medtronic</em> that <a href="http://www.fda.gov/">FDA</a> approval of certain medical devices protects manufacturers from product liability lawsuits filed in state courts. (...)        </p>
        <p><a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=55290">Internal Documents Indicate Two FDA Officials Objected To Rules Aimed at Pre-Empting Lawsuits</a><br />
kaisernetwork.org 30.10.2008<br />
Two <a href="http://www.fda.gov/">FDA</a> officials objected to rules recently issued by the agency that sought to limit the ability of consumers to file product liability lawsuits against pharmaceutical companies in state courts, according to internal documents released on Wednesday by <a href="http://oversight.house.gov/">House Oversight and Government Reform Committee </a>Chair Henry Waxman (D-Calif.), the <a href="http://online.wsj.com/article/SB122529821388980687.html"><em>Wall Street Journal</em></a> reports (Mundy, <em>Wall Street Journal</em>, 10/30). (...) </p>
        <p>According to the documents, two FDA officials in memos said that FDA approval of medication labels are not completely reliable or based on full disclosure of safety risks by pharmaceutical companies. The &quot;internal documents also revealed that the White House played a significant role in drafting the industry-friendly rules&quot; in support of pre-emption, <em>CongressDaily</em> reports (<em>CongressDaily</em>, 10/29). (...) </p>
        <p><a href="http://www.citizen.org/pressroom/release.cfm?ID=2757">Congressional Report Lays to Waste Bush Administration&rsquo;s Pre-emption Claims</a><br />
          citizen.org 29.10.2008 (Public Citizen) <br />
        A report issued today by the House Oversight and Government Reform Committee is proof that the Bush administration has pulled out the stops to shield drug companies from liability for dangerous drugs while leaving patients out in the cold. The report, based on documents obtained from the Food and Drug Administration (FDA), concludes that the agency&rsquo;s efforts to protect drug companies delayed the dissemination of important safety information to the public. The documents reveal that top FDA officials who deal with drug safety on a day-to-day basis do not believe that lawsuits undermine consumer safety, but their views were overridden by political appointees who lacked any empirical support for their views.</p>
        <p> It&rsquo;s bad enough that politics consistently trumps science with this administration. But here we have clear documentation of how the White House hijacked an agency and forced it to undermine its own mission, which is to protect patients. (...)        </p>
        <p><a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=55189">Pharmaceutical Industry Spends More Than $13M on Ads 'Thanking' Lawmakers Who Supported SCHIP Legislation</a> (<span class="color_lightgreen">Legemiddelindustrien bruker mer enn 13 millioner dollar p&aring; reklame som &quot;takker&quot; lovgiverne som st&oslash;ttet SCHIP-lovgivning</span>)<br />
          kaisernetwork.org 24.10.2008<br />
The pharmaceutical industry has paid $13.2 million for television advertisements that &quot;thank&quot; 28 federal lawmakers -- 25 of whom are Democrats -- who supported the 2007 SCHIP expansion legislation, the <a href="http://online.wsj.com/article/SB122480762067065051.html"><em>Wall Street Journal</em></a> reports. The ad campaign is &quot;an example of how interest groups are already adjusting to the prospect of stronger Democratic control of Congress in 2009,&quot; and of how &quot;after years of donating overwhelmingly to Republicans, the pharmaceutical industry is now splitting campaign contributions between the political parties,&quot; according to the Journal. (...)</p>
        <p><a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=54584">PhRMA Contributes $11.3M To SCHIP Advertising Campaign</a><br />
  kaisernetwork.org 22.9.2008<br />
  The <a href="http://www.phrma.org/">Pharmaceutical Research and Manufacturers of America</a> has contributed $11.3 million to the advocacy group <a href="http://www.americasagenda-kidshealth.org/">America's Agenda: Health Care for Kids</a> for advertisements supporting SCHIP expansion, <a href="http://corporate.cq.com/wmspage.cfm?parm1=95"><em>CQ HealthBeat</em></a> reports. The ads will appear in at least 25 lawmakers' states and congressional districts. The ads do not name SCHIP specifically but commend lawmakers who supported a bill (<a href="http://thomas.loc.gov/cgi-bin/query/z?c110:H.R.3963:">HR 3963</a>) that would have expanded SCHIP. President Bush vetoed the bill, citing cost concerns (Jansen, <em>CQ HealthBeat</em>, 9/19). (...) </p>
        <p><a name="urovekkende_dekonstruksjon" id="urovekkende"></a><a href="http://www.nrk.no/nyheter/distrikt/sorlandet/1.6206366">- Urovekkende</a><br />
nrk.no 4.9.2008<br />
Mange vet ikke hvordan de skal f&aring; juridisk hjelp dersom de trenger dette. (...)</p>
        <p>Dette viser en ny unders&oslash;kelse utf&oslash;rt for Norges Juristforbund.</p>
        <p> - Dette er et urovekkende h&oslash;yt tall og viser oss at informasjonen om hvor du kan f&aring; hjelp m&aring; bli bedre.</p>
        <p> Det sier prosjektleder for Juristdagen i Kristiansand Synn&oslash;ve Spinnangr. (...)        </p>
        <p><a name="rettens_pris" id="rettens_pris"></a><a href="http://www.dagbladet.no/nyheter/2008/08/26/544776.html">Rettens pris</a><br />
          dagbladet.no 26.8.2008<br />
        Siden 2004 er 691 personer straffeforfulgt uten grunn, viser tall VG har hentet inn fra Justissekretariatet. I samme periode er det utbetalt 60 millioner kroner i erstatning til personer som har opplevd urettmessig bruk av tvangsmidler. Dette omfatter bl.a. urettmessig fengsling, husransakelse og telefonavlytting mot personer som er siktet for straffbare forhold. Tallene gir selvf&oslash;lgelig ingen total oversikt over urettmessig tvangsbruk eller regelrette justismord. M&oslash;rketallene kjenner vi ikke, men bare det som kommer til overflaten er sterkt bekymringsfullt. </p>
        <p>Tallene burde ogs&aring; bekymre justismyndighetene, men det er ikke tilfelle. Tvert imot sier statsadvokat Harald Strand hos Riksadvokaten at niv&aring;et ikke er s&aelig;rlig h&oslash;yt. (...) </p>
        <p><a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=54131">Editorial Addresses NEJM Commentary on Pre-Emption</a><br />
kaisernetwork.org 25.8.2008 <br />
A <a href="http://www.lasvegassun.com/news/2008/aug/23/protecting-consumer/"><em>Las Vegas Sun</em></a> editorial agrees with the <a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=54013">editors</a> of the <em>New England Journal of Medicine</em> &quot;who say that taking away consumers' right to sue would also take away a strong incentive for the FDA and the pharmaceutical industry to be open about a drug's potential for causing harm.&quot; According to the editorial, the <em>NEJM</em> editors &quot;state the obvious&quot; that FDA and the pharmaceutical companies &quot;haven't always been completely open or correct in their labeling, even when the risk of lawsuits has been present.&quot; The editorial concludes, &quot;Preserving the right of consumers to sue will keep federal agencies and manufacturers more honest -- and the public more protected&quot; (<em>Las Vegas Sun</em>, 8/23). (...) </p>
        <p><a href="http://www.lasvegassun.com/news/2008/aug/23/protecting-consumer/">Sun Editorial: <br />
  Protecting the consumer</a><br />
  lasvegassun.com 23.8.2008<br />
  Federally approved labels should not serve as legal immunity for manufacturers</p>
        <p>Many of the recent criticisms of the Food and Drug Administration have been directed toward one of the agency&rsquo;s most important responsibilities: determining whether prescription drugs are safe before they are allowed on the market.</p>
        <p> It is within this context that a case to be heard by the U.S. Supreme Court in November is attracting attention, including from the editors of the New England Journal of Medicine. (...) </p>
        <p><a href="http://money.cnn.com/news/newsfeeds/articles/apwire/1f5d5d65647ba63ffc05c600030246e6.htm">New FDA labeling rule could be lawsuit shield</a> (<span class="color_lightgreen">Nye FDA regler for preparatomtaler kan v&aelig;re skjold mot s&oslash;ksm&aring;l</span>) <br />
money.cnn.com 22.8.2008<br />
FDA rule on drug labeling attracts praise from drugmakers, ire from lawyers </p>
        <p>NEW YORK (Associated Press) - Government regulators have issued new rules designed to keep drug warning labels clear and concise, though some say the new guidelines would also shield drugmakers from lawsuits.</p>
        <p> The regulations from the Food and Drug Administration, which were released Thursday and take effect next month, explain when drug and medical device companies are responsible for rushing out safety updates on their products.</p>
        <p> The Pharmaceutical Research and Manufacturers of America welcomed the announcement, saying it provides much-needed clarity. But trial lawyers who represent consumers said it will provide legal protection to companies that withhold information on their products' risks. (...)</p>
        <p><a href="http://www.kaisernetwork.org/daily_reports/rep_index.cfm?DR_ID=54013">Lawsuits Help Ensure Drug Safety, NEJM Editors Say</a> (<span class="color_lightgreen">S&oslash;ksm&aring;l hjelper til med &aring; sikre legemiddelsikkerhet</span>) <br />
          kaisernetwork.org 18.8.2008          <br />
          <a href="http://www.fda.gov/">FDA</a> by itself cannot guarantee drug safety and state-level lawsuits are &quot;a vital deterrent&quot; to help protect consumers against drugmakers that do not disclose all risks associated with a treatment, editors of the <em>New England Journal of Medicine</em> wrote in a friend-of-the-court brief on Thursday, the <a href="http://www.orlandosentinel.com/news/politics/nation/sns-ap-fda-drug-safety-lawsuit,0,540925.story"><em>AP/Orlando Sentinel</em></a> reports (Alonso-Zaldivar, <em>AP/Orlando Sentinel</em>, 8/15). The brief is related to an upcoming Supreme Court case involving <a href="http://www.wyeth.com/">Wyeth</a>. </p>
        <p>In the case, <em>Wyeth v. Levine</em>, Diana Levine, a Vermont musician who lost her arm after receiving the nausea drug Phenergan, claims that the drugmaker did not adequately disclose the drug's risks. A Vermont court ruled in her favor, awarding her $6.8 million. Wyeth has appealed the ruling and argues that because FDA weighed the risks and benefits of the drug and approved it, the company is not liable -- a legal doctrine known as pre-emption. The Supreme Court case will &quot;test this legal doctrine ... for prescription drugs,&quot; the <em>Wall Street Journal</em>'s &quot;<a href="http://blogs.wsj.com/health/2008/08/15/nejm-editors-enter-supreme-court-fray-over-drug-risks/print/">Health Blog</a>&quot; reports (Mundy, &quot;Health Blog,&quot; <em>Wall Street Journal</em>, 8/15). (...) </p>
        <p><a name="garantist_for_legemiddelsikkerhet" id="garantist_for_legemiddelsikkerhet"></a><a href="http://www.usatoday.com/news/health/2008-08-15-drug-lawsuits_N.htm">Doctors: Lawsuits help guarantee drug safety</a> (<span class="color_lightgreen">Leger: S&oslash;ksm&aring;l bidrar som garantist for legemiddelsikkerhet</span>) <br />
  usatoday.com 15.8.2008<br />
  WASHINGTON (AP) &mdash; Top doctors who run one of the most influential U.S. medical journals are giving the U.S. Supreme Court some unsolicited legal advice about a major case.</p>
        <p> Lawsuits can serve as &quot;a vital deterrent&quot; and protect consumers if drug companies do not disclose risks to the U.S. Food and Drug Administration before it approves medicines for use, the editors of the New England Journal of Medicine said in a friend-of-the-court brief. The FDA &quot;is in no position&quot; to guarantee drug safety, the brief said.</p>
        <p> At issue is Wyeth v. Levine, a case expected to be heard late this year that could have far-reaching implications for litigation over allegedly harmful drugs, such as the painkiller Vioxx. (...) </p>
        <p><a name="kostnader_rettssaker" id="kostnader_rettssaker"></a><a href="http://www.pharmalot.com/2008/08/new-rule-to-force-pharma-to-disclose-lawsuit-costs/">New Rule Forces Pharma To Disclose Lawsuit Costs</a> (<span class="color_lightgreen">Nye regler tvinger legemiddelfirmaer til &aring; offentliggj&oslash;re kostnader for rettssaker</span>)<br />
          pharmalot.com 8.8.2008<br />
        We all know litigation costs money. But right now, companies are required to estimate the cost of a lawsuit only when it is likely a loss is in the offing. But the Financial Accounting Standards Board wants, instead, to require companies to account for the potential cost of all ongoing litigation - period. (...)</p>
        <p>Several drugmakers, however, are not pleased. And so Lilly, Johnson &amp; Johnson, Merck, Novartis, Pfizer and Wyeth teamed up to write a letter to FASB saying this is a bad idea, especially for companies that defend mass torts, or widespread product liability litigation. (Can you say Vioxx or fen-phen?) And so they write&hellip; (...)</p>
        <p>The drugmakers are also &ldquo;concerned that the new disclosure rules will undermine the attorney-client privilege and work product protection and, more generally, will tilt the litigation balance in favor of disclosing companies&rsquo; litigation adversaries and, thus, work to the ultimate detriment of our shareholders without providing meaningful disclosure to investors.&rdquo;</p>
        <p> Maybe not, but since every drugmaker is locked in product-liability litigation - not to mention other types of lawsuits - you can imagine what this will do to the betting on Wall Street. (...)        </p>
        <p><a href="http://politiken.dk/udland/article542803.ece">Berlusconi f&aring;r juridisk immunitet</a><br />
          politiken.dk 23.7.2008<br />
        Det italienske senat vedtager lov, der giver Silvio Berlusconi juridisk immunitet, s&aring; l&aelig;nge han er premierminister. (...)</p>
        <p><strong>Berlusconi f&aring;r st&oslash;rst fordel</strong><br />
        Den nye lov giver immunitet til de fire politiske mest magtfulde poster i Italien. Det er pr&aelig;sidenten, premierministeren og form&aelig;ndene for parlamentets to kamre. </p>
        <p>Loven blev vedtaget med 171 stemmer for, mens 128 stemte imod. Parlamentets underhus vedtog loven tidligere i juli. </p>
        <p>Den f&oslash;rste, der f&aring;r fordel af den ny lov, er den 71-&aring;rige Silvio Berlusconi, der er anklaget for at have betalt en britisk advokat godt tre millioner kroner for at komme med fordelagtige udsagn ved to retssager mod Berlusconi. (...)</p>
        <p><a name="viktige_tap_i_retten" id="viktige_tap_i_retten"></a><a href="http://www.aftenposten.no/klima/article2516410.ece">Viktige tap i retten</a><a href="http://www.aftenposten.no/klima/article2516410.ece"> for forurensningsofre i Kina</a><br />
  aftenposten.no 1.7.2008<br />
  BEIJING (Aftenposten.no): - Vi taper de fleste sakene, men vi gj&oslash;r likevel et viktig arbeid, mener frivillig organisasjon som gir juridisk bistand til ofre for forurensning i Kina. </p>
        <p>P&aring; minst to m&aring;ter representerer Center for Legal Assistance to Pollution Victims (CLAPV) noe nytt i Kina. </p>
        <p> For det f&oslash;rste er det en ikke-statlige frivillig organisasjon, noe som kinesiske myndigheter hittil har sett p&aring; med begrenset begeistring. </p>
        <p> <a href="http://www.aftenposten.no/informasjon/article213494.ece">Senterets internettside</a> er sperret i Kina. <br />
  Dernest fors&oslash;ker senteret &aring; ta rettsapparatet i bruk for &aring; skape &aring;penhet om milj&oslash;problemer og bidra til bedre h&aring;ndheving av Kinas milj&oslash;lovverk. (...) </p>
        <p>CLAPV har mottatt st&oslash;tte fra Det norske utenriksdepartementet, og de har sendt en ny s&oslash;knad om ytterligere st&oslash;tte som n&aring; er til behandling. (...) </p>
        <p><a href="http://www.detnews.com/apps/pbcs.dll/article?AID=/20080514/OPINION01/805140325/1008">Merck revelations make state's drug immunity a bitter pill to swallow</a><br />Wednesday, May 14, 2008 <br />
          How should Michigan reform legal system?<br />
          Sen. John J. Gleason<br />
        Drug manufacturing goliath Merck was in the headlines again last month. As we're growing accustom to, the news was not good. </p>
        <p> Two new reports were released in the Journal of the American Medical Association that claim Merck &amp; Co. frequently paid academic scientists to take credit for research articles prepared by company-hired medical writers, a practice called ghostwriting, to promote their products. They also assert that Merck tried to minimize deaths in two studies that showed that the now-withdrawn drug Vioxx didn't work at treating or preventing Alzheimer's disease. </p>
        <p> This is the latest in a growing string of incidents involving Merck and Vioxx, and it again underscores the urgent need to pass my legislation, Senate Bill 43, which would outlaw drug industry immunity in Michigan -- the only state in the nation that still allows such protection. (...) </p>
        <p>A few months ago, Merck and another drug manufacturing giant, Schering-Plough, acknowledged that they had withheld the results of a study on Vytorin showing patients who took the cholesterol-lowering drug faced an increased risk of heart attacks and strokes. And now we have another scandal with the accusations that they falsified their drug studies and ghostwrote their own research. (...) </p>
        <p><a href="http://www.nrk.no/nyheter/1.5635957">Mange overgrep i norsk psykiatri</a><br />
nrk.no 11.5.2008<br />
Brudd p&aring; menneskerettighetene florerer i norsk psykiatri, mener advokat og ekspert p&aring; menneskerettigheter, Gro Hillestad Thune. (...) </p>
        <p>- Mennesker med psykiske lidelser har d&aring;rligere rettsvern enn lovbrytere, sier advokaten. Hun har skrevet boken &quot;Overgrep - s&oslash;kelys p&aring; psykiatrien&quot;.</p>
        <p> I radioprogrammet &quot;S&oslash;ndagsavisa&quot; p&aring; NRK P2 sa helsepolitisk talsmann for SV, Olav Gunnar Ballo, at mange av overgrepene kan sidestilles med voldtekt. (...) </p>
        <p><a href="http://www.na24.no/propaganda/media/article1781889.ece">Rike og sinte p&aring; pressen</a><br />
          na24.no 24.4.2008<br />
        - Du skal v&aelig;re enten veldig sint, eller ha god r&aring;d for &aring; fremme et injuries&oslash;ksm&aring;l, mener jusprofessor. (...)</p>
        <p>- Mitt inntrykk er at n&aring;r vi har injuriesaker er det kjente personer som f&oslash;rer dem. Kjendiser i en eller annen forstand, eller finansfolk med god r&aring;d. Du skal v&aelig;re enten veldig sint eller ha god r&aring;d for &aring; fremme et injuries&oslash;ksm&aring;l. For du m&aring; ha r&aring;d til &aring; tape. Domstolen er ellers veldig fjern for de fleste mennesker, det preger ogs&aring; domstolen i Norge, sier professor i rettsvitenskap Eivind Smith til NA24 Propaganda. (...)        </p>
        <p><a href="http://www.aftenposten.no/meninger/debatt/article1932735.ece">Grei m&aring;te &aring; spare penger p&aring;</a><br />
aftenposten.no 12.8.2007 <br />
Aftenpostens artikkelserie som har satt s&oslash;kelyset p&aring; sosialklienter og deres livssituasjon i dagens Norge, er skremmende lesning. (...)</p>
        <p>Trygdekontorene holder tilbake ytelser, fordi de er umettelige i sine krav om dokumentasjon. (...)</p>
        <p> Kamp mot etatene er trygde- og sosialklienters grelle hverdag. Hvor mange gir opp p&aring; veien? Denne gruppen lever i et av verdens rikeste land, i et av verdens best utviklede demokratier, men er i praksis rettsl&oslash;se. (...)</p>
        <p><a href="http://phoenix.injuryboard.com/defective-products/pharmaceutical-company-threatened-legal-action-against-physician-who-questioned-the-safety-of-diabetes-medication-avandia.php?googleid=8885">Pharmaceutical Company Threatened Legal Action Against Physician Who Questioned the Safety of Diabetes Medication Avandia</a><br />
          phoenix.injuryboard.com 7.6.2007<br />
        (...) Based upon the sales volume alone, sales of this medication account for a huge source of profit for GlaxoSmithKline. In 1999, apparently after a medical researcher attempted to inform the pharmaceutical company about increased heart risks which have recently been disclosed publicly, company officers allegedly threatened litigation and:</p>
        <p> warned him that some executives wanted to hold him accountable for a $4 billion drop in the company's stock.<br />
        The medical researcher testified in a congressional hearing this week that he wrote to the company and:</p>
        <p> In a letter to SmithKline distributed at the hearing, Buse wrote: &quot;Please call off the dogs. I cannot remain civilized much longer under this kind of heat.&quot; (...)
        </p>
        <p><a href="http://www.aftenposten.no/meninger/leder_morgen/article1805826.ece">Oppgj&oslash;r med korrupsjonen</a><br />
          aftenposten.no 26.5.2007<br />
          ET S&Oslash;KELYS p&aring; verdens tilstand er blitt satt gjennom to internasjonale rapporter som er offentliggjort de siste dager: Samtidig som menneskerettsorganisasjonen Amnesty har sendt ut sin &aring;rvisse beretning om brudd p&aring; menneskerettighetene, har antikorrupsjonsselskapet Transparency offentliggjort en oversikt over hvordan korrupsjon truer rettsvesenet, gjennom korrupte dommere og jurister. (...)
        </p>
        <p><a href="http://www.forskning.no/Artikler/2007/mai/1179150088.8">Urettferdighet gir hjertetr&oslash;bbel</a><br />
          forskning.no 15.5.2007<br />

          Det &aring; bli urettferdig behandlet er visst ikke bare trist og irriterende. Det &oslash;ker ogs&aring; risikoen for &aring; ende opp med angina eller hjerteanfall, mener forskere. (...)        </p>
        <p><a href="http://www.aftenposten.no/meninger/article1765404.ece">Lettvinte dommere</a><br />
          aftenposten.no 2.5.2007<br />
          YTRINGSFRIHET. Pressens rett til &aring; referere fra rettsm&oslash;ter ligger i kjernen av ytringsfriheten. Likevel opplever vi stadig dommere som fraviker dette prinsippet. (...)
</p>
        <p>For oss som sliter trebenkene i rettslokaler landet over, er det frustrerende &aring; se hvor lett enkelte dommere nekter oss &aring; bringe videre det som skjer. (...)        </p>
        <p><a href="http://www.forskningsradet.no/servlet/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a><br />forskningsradet.no 4.5.2007<br />Rettsvitenskapens dag <br />
reference not terminated by REFC delimiter
Line: 5293, Col: 96
…/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/V…
reference to external entity in attribute value
Line: 5293, Col: 96
…/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/V…
cannot generate system identifier for general entity "cid"
Line: 5293, Col: 158
…nerellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!<…
reference not terminated by REFC delimiter
Line: 5293, Col: 161
…ellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a>…
reference to external entity in attribute value
Line: 5293, Col: 161
…ellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a>…
reference to entity "pagename" for which no system identifier could be generated
Line: 5293, Col: 96
…/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/V…
general entity "cid" not defined and no default entity
Line: 5293, Col: 158
…nerellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!<…
reference to entity "cid" for which no system identifier could be generated
Line: 5293, Col: 161
…ellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a>…
        Dette ble p&aring;vist med all &oslash;nskelig tydelighet p&aring; &quot;Rettsvitenskapens dag&quot; 26. april, arrangert av de juridiske fakultetene ved universitetene i Oslo, Bergen og Troms&oslash;. (...)</p>
        <p>I fem parallelle sesjoner ble det foredratt om netthandel, granskingskommisjoner, tvangsinnleggelse, internasjonal klimaregulering, barnekonvensjonens plass i utlendingsretten og en hel del annet - under overskriftene Strafferett, Formuerett, Forvaltning og forfatning, Internasjonalisering og Sosialrett og samfunnsvitenskap. (...)</p>
        <p>Professor Kjersti Ericsson og postdoktor Karen-Sofie Pettersen dr&oslash;ftet muligheter og problemer knyttet til billighetserstatningsordningen. (...)</p>
        <p>Flere sp&oslash;rsm&aring;l kan reises i denne sammenhengen: Har samfunnet historiske forpliktelser - og i tilfelle ja, hvor langt tilbake i tid, hva kan gj&oslash;res og hvordan skal ansvaret avveies i forhold til andre forpliktelser og rettigheter? (...)</p>
        <p><strong>Rus og tvang</strong><br />
        Tvangsinnleggelse av rusmisbrukere er &oslash;kende, sa f&oslash;rsteamanuensis Harald S&oslash;vig i sitt foredrag. Men misbrukerne har ogs&aring; anledning til &aring; underkaste seg &quot;frivillig tvang&quot;, de kan samtykke i &aring; bli holdt tilbake en viss tid. (...)</p>
        <p><strong>Professor Jan Fridthjof Bernt. </strong><br />
For det f&oslash;rste er det en tett forbindelse mellom rettsvitenskapen og den praktisk utf&oslash;rte jusen. Dessuten er praktisk jus premissleverand&oslash;r til rettsvitenskapen. Og begrepet &quot;gjeldende rett&quot; er et fenomen i stadig bevegelse, det er ikke slik at gjeldende rett bare endres ved vedtak fra lovgiver. En dynamisk rettsforst&aring;else er n&oslash;dvendig, mente Bernt.</p>
        <p> Retten vil alltid v&aelig;re &quot;uferdig&quot;. P&aring; denne m&aring;ten blir jus n&aelig;rt knyttet til politikk - &quot;Det er med jusen og politikken som med leoparden og flekkene&quot;, har historikeren Jens Arup Seip uttalt.</p>
        <p> Jusen er alts&aring; ikke verdin&oslash;ytral, og viktige sp&oslash;rsm&aring;l blir hvilke verdier som skal styre v&aring;r utlegning av gjeldende rett og hva slags rettsvitenskap samfunnet har bruk for.</p>
        <p> Bernt s&aring; som viktige oppgaver for rettsvitenskapen &aring; ivareta de overordnede perspektivene for rettssystemet ved &aring; se sammenhenger, b&aring;de i regelverket og mellom politiske og rettslige diskusjoner, analysere faktiske og verdimessige premisser for regelforst&aring;else og bidra til den rettspolitiske debatten. (...) </p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/voldsoffererstatning.php">Voldsoffererstatning (vold) (mintankesmie.no)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://frirettshjelp.no/innvilgelseskompetanse">Fri rettshjelp (frirettshjelp.no/innvilgelseskompetanse)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/diverse_skadeerstatninger.php#to_tredjedeler">– Tall fra Statens sivilrettsforvaltning, som bygger på innrapportering fra fylkesmennene, viser at så mange som to tredjedeler fikk avslag på sine søknader om fri rettshjelp i perioden 2010 til 2012 Saksøker staten – nektes fri rettshjelp  (nrk.no 19.11.2013</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/norsk_pasientskadeerstatning.php#">Norsk pasientskadeerstatning (NPE). (mintankesmie.no)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/gruppesoksmol.php">Gruppes&oslash;ksm&aring;l (masses&oslash;ksm&aring;l) (mintankesmie.no)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/fylkeslegen_helsetilsynet_fylkesmannen.php">Klager: Fylkeslegen – Helsetilsynet (Statens helsetilsyn) - Fylkesmannen - Fylkesnemndene for barnevern og sosiale saker (mintankesmie.no)</a>.)</p>
                      <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/sivilombudsmannen.php">Sivilombudsmannen (SOM)  (mintankesmie.no)</a>.)</p>
        <p>(<strong>Anm</strong>:  <a href="http://www.mintankesmie.no/rettferdsvederlag.php">Rettferdsvederlag (Stortingets rettferdsvederlagsordning) (tidligere billighetserstatning) (mintankesmie.no)</a>.) </p><h3>- Statens  oppreisningsansvar ved menneskerettighetsbrudd. 
                      </h3>
                      <p>(<strong>Anm</strong>:  Statens  oppreisningsansvar ved menneskerettighetsbrudd. I Norge har erstatningsretten  utviklet seg parallelt med –&nbsp;og uavhengig av –&nbsp;en stadig større bruk  av menneskerettigheter i offentlig rett og i privatretten for øvrig.  Menneskerettighetene har derfor ikke fullt ut ... <a href="https://www.idunn.no/tidsskrift_for_erstatningsrett_forsikringsrett_og_trygderett/2017/01/statens_oppreisningsansvar_ved_menneskerettighetsbrudd">Tidsskrift  for erstatningsrett, forsikringsrett og trygderett01 / 2017 (Volum 2) Side: 3-6</a>.)</p>
<h3>- Erstatning for ikke-økonomisk tap ved krenkelser av EMK.</h3>
<p> (<strong>Anm</strong>:  Av Henrik  Vaaler - (master i rettsvitenskap 2016) jobber som advokatfullmektig i Regjeringsadvokaten.  Erstatning for ikke-økonomisk tap ved&nbsp;krenkelser&nbsp;av EMK. <strong>Sammendrag. </strong>EMK artikkel 13 gir  personer som har vært utsatt for konvensjonskrenkelser, rett til et effektivt  botemiddel på nasjonalt nivå. For å være effektivt må botemidlet kunne gi  reparasjon. Artikkelen redegjør for når reparasjonen må bestå i erstatning for  ikke-økonomisk tap, og hvilke følger det får for ansvarsgrunnlaget  i&nbsp;nasjonal rett. Avslutningsvis går artikkelen inn på norsk rett, og fastlegger  når artikkel 13 bør kunne anvendes direkte som erstatningsgrunnlag for norske  domstoler. I en rekke saker de siste årene har private parter gått til norske domstoler og krevd erstatning for krenkelser av Den europeiske menneskerettskonvensjon (EMK). Antallet søksmål synes å være økende. Sakene har til felles at saksøkerne, foruten å påberope ulovfestet objektivt ansvar eller oppreisningsbestemmelsen i skadeserstatningsloven (ski.) § 3-5, anfører at staten er forpliktet etter EMK til å tilkjenne erstatning for øko­nomisk og ikke-økonomisk tap på objektivt grunnlag ved krenkelser av konvensjonen, og at EMK utgjør et selvstendig erstatningsgrunnlag i norsk rett. Artikkelen vil se nærmere på begge spørsmålene.(...) <strong>AVSLUTTENDE BEMERKNINGER</strong> Ved å anvende artikkel  13 direkte som erstatningsgrunnlag vil norsk rett klart tilby et effektivt  botemiddel. En direkte tillempning av artikkel 13 er likevel ikke den eneste  eller nødvendigvis den beste måten å overholde konvensjonen på. Artikkel 13 er  ikke utformet med sikte på å være en nasjonal erstatningshjemmel, og tilbyr  ikke noen hel­hetlig erstatningslære. (...) <a href="https://www.idunn.no/lor/2017/05/erstatning_for_ikke-oekonomisk_tap_vedkrenkelserav_emk">Lov  og Rett 05 / 2017 (Volum 56)Side: 299-317</a>.)</p>
        <p><a href="http://www.dn.no/forsiden/politikkSamfunn/article1062398.ece?WT.mc_id=dn_nyhetsbrev">- Sterke venner truer rettsstaten</a><br />
          dn.no 2.4.2007<br />
          (...) <strong>&quot;Farlig tendens&quot;</strong><br />
        Eriksen mener maktmenneskene viser en usedvanlig mangel p&aring; systemforst&aring;else og utgj&oslash;r en farlig tendens for rettsstaten.</p>
        <p> &ndash; Vi ser i stadig sterkere grad at ressurssterke folk bruker medier&aring;dgivere og venner for &aring; sverte p&aring;talemyndigheten, sier Eriksen til DN. (...)</p>
			       </div>
						<div class="column4">
							<div class="photo-box">
								<div class="location">
									MinTankesmie.no 
									<em><a href="https://www.timeanddate.no/kalender/">28.05.2018  - Uke 22</a></em>
								</div>
							</div>
                                   
							<div class="sb-list">
								<div class="top"></div>
								<div id="purple_bg">
<div class="mid-icons"><ul id="snarveier">
	<li class="global_middeltemperatur"><a href="http://www.miljostatus.no/tema/klima/klimaendringer-globalt/temperaturokning/" title="Global middeltemperatur 1860 - 2010 (Miljøstatus i Norge) (Miljøverndepartementet - Statens forurensningstilsyn)">miljøstatus.no</a></li>
	<li class="global_disease"><a href="http://healthmap.org/en" title="HealthMap (Global disease alert map)">healthmap.org</a></li>
	<li class="kart_mns_live"><a href="http://www.globalhandwashingday.org/" title="Global Handwashing Day">Global Handwashing Day</a></li>
	<li class="world_clock"><a href="http://www.poodwaddle.com/clocks2.htm" title="World Clock (World Population)">poodwaddle.com</a></li>
	<li class="worlds_languages"><a href="http://www.unesco.org/culture/languages-atlas/" title="UNESCO Interactive Atlas of the World’s Languages in Danger">unesco.org</a></li>
	<li class="world_mapper"><a href="http://www.worldmapper.org/thumbnails/mapindex1-12.html" title="Worldmapper (The world as you've never seen it before)">worldmapper.org</a></li>
	<li class="kart_mns_live"><a href="http://www.bing.com/maps/" title="Bing Maps (Microsoft)">bing.com - Maps</a></li>
	<li class="kart_google"><a href="http://maps.google.no/" title="Google maps">google.com - Maps</a></li>
	<li class="initiative"><a href="http://www.openbudgetindex.org/" title="The Open Budget Initiative (Initiative) (80 Percent of Governments Don't Account for Spending)">openbudgetindex.org</a></li>
	<li class="vaeretworld"><a href="http://www.bbc.co.uk/weather/" title="V&aelig;ret - Verden (BBC Weather Centre in association with the Met Office)">bbc.co.uk</a></li>
	<li class="pop_clock"><a href="http://opr.princeton.edu/popclock/" title="The World Population Clock">princeton.edu</a></li>
	</ul>
</div>
</div>
								<div class="bottom"></div>
							</div>
							
							<div class="advertisement">
								Ad Here
							</div>
							
						</div>
				  </div>
					<p class="foot">
						Websidene er designet og tilrettelagt av Hein Tore T&oslash;nnesen &copy; 2009
					</p>
					<div class="space"></div>
					
				</div>	
		  </div>			
		</div>

		<div id="footerwrap">
			<div class="footer">
			   <div class="footer-inner">
				 <div class="right">
				    <form action="https://twitter.com/search?q=$sokeord" id="twitter-search-box">
   <div id="twitsearch">
	 <input type="text" name="q" class="twit-input clearbackground" value="" />
	 <input type="image" src="images/search-twitter-bt.png" name="sa" value="S&oslash;k" id="tw_button" />
   </div>
</form>				 </div>
				 <div class="right inner">
				    <a href="" class="foot-btn" rel="expand_right"><span>Flere lenker</span></a>
				    <ul>
					  <li><a href="https://www.digipost.no/">Digipost</a></li>
					  <li><a href="1_300_mintankesmie.php">(A-&Aring;)</a></li>
				    </ul>
				 </div>
									<div class="left">
					  <form action="http://www.mintankesmie.no/google_sok.php" id="cse-search-box">
						<div id="cse">
						   <input type="hidden" name="cx" value="017408530430315144789:iwr487fcg98" />
						   <input type="hidden" name="cof" value="FORID:11" />
						   <input type="hidden" name="ie" value="UTF-8" />
						   <input class="gsc-input" type="text" name="q" />
						   <input type="image" src="images/search-google-bt.png" name="sa" value="S&oslash;k" id="gg_button" />
						</div>
					  </form>
					  <script type="text/javascript" src="http://www.google.com/cse/brand?form=cse-search-box&amp;lang=no"></script>
					</div>
					<div class="left inner">
					  <ul>
						<li><a href="http://tjenester.norge.no/nb/" title="Norge.no (Finn tjeneste)">Norge.no</a></li>
						<li><a href="a_a_mintankesmie.php">(A-&Aring;)</a></li>
					  </ul>
					  <a href="" class="foot-btn" rel="expand_left"><span>Flere lenker</span></a>
					</div>			   </div>
			</div>
			<div class="expand">
				<ul id="expand_left">
								<li class="vis_script"><a href="https://www.altinn.no/" title="Altinn (tjenester for...)">Altinn</a></li>
				<li class="vis_script"><a href="http://helsenorge.no/" title="Helsenorge.no">Helsenorge.no</a></li>
				<li class="vis_script"><a href="http://ehealthresearch.no/" title="Nasjonalt senter for e-helseforskning">Nasjonalt senter for e-helseforskning</a></li>
				<li class="vis_script"><a href="https://ehelse.no/" title="Direktoratet for e-helse">Direktoratet for e-helse</a></li>
				<li class="vis_script"><a href="http://www.frittsykehusvalg.no/" title="Fritt sykehusvalg">Fritt sykehusvalg</a></li>
				<li class="vis_script"><a href="http://tjenester.norge.no/" title="Norge.no">Norge.no - veiviser til offentlige tjenester på nett</a></li>
				<li class="vis_script"><a href="http://www.kriseinfo.no/" title="Kriseinfo.no Din inngang til myndighetenes kriseinformasjon">Kriseinfo.no Din inngang til myndighetenes kriseinformasjon</a></li>
				<li class="vis_script"><a href="http://www.legevakten.no/" title="Legevakten.no - oversikt over alle norske, kommunale legevakter">Legevakten.no - oversikt over alle norske, kommunale legevakter</a></li> 
				<li class="vis_script"><a href="http://www.erdetfarlig.no/" title="ER DET FARLIG">ER DET FARLIG</a></li>
				<li class="vis_script"><a href="http://helsenorge.no/Selvbetjening/Sider/Mine-vaksiner/Om-Mine-vaksiner.aspx" title="Mine vaksiner">Mine vaksiner</a></li>
				<li class="vis_script"><a href="https://tjenester.nav.no/minfastlege/innbygger/visloginside.do" title="MinFastlege">MinFastlege</a></li>
				<li class="vis_script"><a href="https://www.mineresepter.no/" title="Mine Resepter">Mine Resepter</a></li> 
				<li class="vis_script"><a href="http://www.legemiddelverket.no/Bivirkninger/Meld_bivirkninger/pasientmelding/Sider/default.aspx" title="Meld bivirkninger - pasienter - elektronisk ID (Statens legemiddelverk (SLV))">Meld bivirkninger - pasienter - elektronisk ID (Statens legemiddelverk (SLV))</a></li>
				<li class="vis_script"><a href="http://www.helseregistre.no/" title="Sentrale helseregistre (helseregistre.no)">Sentrale helseregistre (helseregistre.no)</a></li>
				<li class="vis_script"><a href="http://apotekhjem.no/" title="Apotekhjem.no">Apotekhjem.no</a></li>
				<li class="vis_script"><a href="https://enklereregler.regjeringen.no/" title="ENKLERE REGLER.no (Vi vil gjøre det enklere for norsk næringsliv)">ENKLERE REGLER.no (Vi vil gjøre det enklere for norsk næringsliv)</a></li>
				<li class="vis_script"><a href="http://helsenorge.no/" title="helsenorge.no">helsenorge.no</a></li>
				<li class="vis_script"><a href="http://sunnskepsis.no/" title="Sunn Skepsis">Sunn Skepsis</a></li>
				<li class="vis_script"><a href="https://www.norskpensjon.no/" title="Norsk Pensjon AS">Norsk Pensjon AS</a></li>
				<li class="vis_script"><a href="http://www.nav.no/Pensjon/Din+pensjon" title="Din pensjon (NAV)">Din pensjon (NAV)</a></li>
				<li class="vis_script"><a href="http://www.skatteetaten.no/" title="Altinn (tjenester for...)">Skatteetaten</a></li>
				<li class="vis_script"><a href="http://www.facebook.com/skattenmin" title="Skatten min (Skatteetaten på Facebook)">Skatten min (Skatteetaten på Facebook)</a></li>
				<li class="vis_script"><a href="http://www.finansportalen.no/" title="inansportalen.no">Finansportalen.no</a></li>
				<li class="vis_script"><a href="http://www.dinside.no/900767/simulatoren-som-viser-veien-til-egen-bolig" title="Sjef i eget liv (Boligsimulator - Husbanken)">Sjef i eget liv (Boligsimulator - Husbanken)</a></li>
				<li class="vis_script"><a href="http://www.Regjeringen.no/" title="Regjeringen.no">Regjeringen.no</a></li>
				<li class="vis_script"><a href="http://www.regjeringen.no/nb/tema_a-aa.html?id=223486" title="Regjeringen.no (A-&Aring;)">(A-Å)</a></li>
				<li class="vis_script"><a href="http://data.norge.no/" title="Data.norge.no">Data.norge.no</a></li>
				<li class="vis_script"><a href="http://www.mednytt.no/" title="Nasjonalt kunnskapssenter for helsetjenesten kunnskapssenteret (NHI) - MedNytt">MedNytt (NHI)</a></li>
				<li class="vis_script"><a href="http://minenergi.enova.no/" title="Min energi (Enova)">Min energi</a></li>
				<li class="vis_script"><a href="http://www.brreg.no/" title="Br&oslash;nn&oslash;ysundregistrene">Brønnøysundregistrene</a></li>
				<li class="vis_script"><a href="http://www.okokrim.no/" title="&Oslash;kokrim">Økokrim</a></li>
				<li class="vis_script"><a href="http://www.fornybar.no/" title="fornybar.no">fornybar.no</a></li>
				<li class="vis_script"><a href="http://www.regelhjelp.no/" title="Regelhjelp.no">Regelhjelp.no</a></li>	
				<li class="vis_script"><a href="https://www.minhelse.no/" title="Minhelse.no">Minhelse.no</a></li>
				<li class="vis_script"><a href="https://www.minjournal.no/" title="Min Journal">Min Journal</a></li>
				<li class="vis_script"><a href="http://www.nav.no/" title="Arbeids- og velferdsetaten (NAV)">Arbeids- og velferdsetaten (NAV)</a></li>
				<li class="vis_script"><a href="http://www.nav.no/page?id=1073743338&amp;query=title+LIKE+%27a%25%27" title="A til &Aring;">(A til Å)</a></li>
				<li class="vis_script"><a href="http://www.frittsykehusvalg.no/" title="Fritt sykehusvalg">Fritt sykehusvalg</a></li>
				<li class="vis_script"><a href="http://www.nav.no/page?id=357" title="Behandlingsfrist p&aring; sykehus">Behandlingsfrist på sykehus</a></li>
				<li class="vis_script"><a href="http://www.regjeringen.no/nb/dep/hod/tema/sykehus/nokkeltall-og-fakta---ny.html?id=528109" title="Sykehus i Norge (De regionale helseforetakene etc.)">Sykehus i Norge (De regionale helseforetakene etc.)</a></li>
				<li class="vis_script"><a href="http://www.pasientombudet.no/" title="Pasient- og brukerombudet (Pobo) (pasientombudet)">Pasient- og brukerombudet (Pobo) (pasientombudet)</a></li>
				<li class="vis_script"><a href="http://www.pasientombudet.no/lenker/" title="(lenker)">(lenker)</a></li>
				<li class="vis_script"><a href="http://www.helfo.no/privatperson/Sider/default.aspx" title="Europeisk helsetrygdekort">Europeisk helsetrygdekort</a></li>
				<li class="vis_script"><a href="https://tjenester.nav.no/helsetrygdkort/forside.do" title="(bestilling)">(bestilling)</a></li>
				<li class="vis_script"><a href="http://www.Jobbressurs.no/" title="jobbressurs.no (Funksjonshemmedes Fellesorganisasjons Ungdom)">jobbressurs.no  (Funksjonshemmedes Fellesorganisasjons Ungdom)</a></li>
				<li class="vis_script"><a href="http://www.npe.no/" title="Norsk Pasientskadeerstatning (NPE)">Norsk Pasientskadeerstatning (NPE)</a></li>
				<li class="vis_script"><a href="http://www.yrkesskadde.no/" title="Yrkesskaddes Forbund (YF)">Yrkesskaddes Forbund (YF)</a></li>
				<li class="vis_script"><a href="http://www.fhi.no/" title="Nasjonalt folkehelseinstitutt (FHI) (N)">Nasjonalt folkehelseinstitutt (FHI) (N)</a></li>
				<li class="vis_script"><a href="http://www.fhi.se/" title="Statens folkh&auml;lsoinstitut Folkh&auml;lsoinstituttet FHI">FHI (S)</a></li>
				<li class="vis_script"><a href="http://www.si-folkesundhed.dk/" title="Statens Institut for Folkesundhed">SIF (DK)</a></li>				
				<li class="vis_script"><a href="http://www.legemiddelverket.no/" title="Statens legemiddelverk (SLV)">Statens legemiddelverk (SLV)</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/" title="U. S. Food and Drug Administration (FDA)">U. S. Food and Drug Administration (FDA)</a></li>
				<li class="vis_script"><a href="http://www.lmi.no/" title="Legemiddelindustriforeningen (LMI)">Legemiddelindustriforeningen (LMI)</a></li>
				<li class="vis_script"><a href="http://www.imi-europe.org/" title="Innovative Medicines Initiative (IMI) - samarbeidsprosjekt mellom legemiddelfirmaer, universiteter, pasientorganisasjoner og myndigheter)">Innovative Medicines Initiative (IMI)</a></li>
				<li class="vis_script"><a href="http://www.regjeringen.no/nb/dep.html?id=933" title="Departementene">Departementene</a></li>
				<li class="vis_script"><a href="http://www.regjeringen.no/nb/dep/hod.html?id=421" title="Helse- og omsorgsdepartementet (HOD)">Helse- og omsorgsdepartementet (HOD)</a></li>
				<li class="vis_script"><a href="http://www.stortinget.no/" title="Stortinget">Stortinget</a></li>
				<li class="vis_script"><a href="http://www.stortinget.no/no/Representanter-og-komiteer/Komiteene/Helse--og-omsorgskomiteen/" title="Helse- og omsorgskomiteen">Helse- og omsorgskomiteen</a></li>
				<li class="vis_script"><a href="http://www.stortinget.no/no/Representanter-og-komiteer/Komiteene/" title="Komiteene">Komiteene</a></li>
				<li class="vis_script"><a href="http://www.legeforeningen.no/" title="Den norske l&aelig;geforening (DNLF)">Den norske lægeforening (DNLF)</a></li>
				<li class="vis_script"><a href="http://www.tidsskriftet.no/pls/lts/pa_lt.poplts" title="Tidsskrift for Den norske legeforening (Tidsskriftet)">Tidsskrift for Den norske legeforening (Tidsskriftet)</a></li>
				<li class="vis_script"><a href="http://www.legeforeningen.no/index.gan?id=14172" title="Allmennlegeforeningen (Aplf)">Allmennlegeforeningen (Aplf)</a></li>
				<li class="vis_script"><a href="http://www.legeforeningen.no/index.gan?id=2640" title="Yngre legers forening (Ylf)">Yngre legers forening (Ylf)</a></li>
				<li class="vis_script"><a href="http://bmj.bmjjournals.com/" title="British Medical Journal (BMJ)">British Medical Journal (BMJ)</a></li>
				<li class="vis_script"><a href="http://content.nejm.org/" title="New England Journal of Medicine (NEJM)">New England Journal of Medicine (NEJM)</a></li>
				<li class="vis_script"><a href="http://www.thelancet.com/" title="Lancet">Lancet</a></li>
				<li class="vis_script"><a href="http://www.difi.no/" title="Direktoratet for forvaltning og IKT (DIFI) (Tidligere Statskonsult)">Direktoratet for forvaltning og IKT (DIFI) (Tidligere Statskonsult)</a></li>
				<li class="vis_script"><a href="http://www.oep.no/" title="Offentlig elektronisk postjournal (OEP)">Offentlig elektronisk postjournal (OEP) (Offentlig  postjournal) </a></li>
				<li class="vis_script"><a href="http://www.europarl.dk/" title="Europa-Parlamentet">Europa-Parlamentet</a></li>
				<li class="vis_script"><a href="http://europa.eu.int/comm/index_da.htm" title="EU-Kommusjonen">EU-Kommusjonen</a></li>
				<li class="vis_script"><a href="http://ec.europa.eu/health-eu/index_en.htm" title="Health-EU Portal">Health-EU Portal (EUs helseportal)</a></li>
				</ul>
				<ul id="expand_right">
				<li class="vis_script"><a href="http://spinspotter.com/mission" title="SpinSpotter (Read the news, not the spin - Bring transparency to journalism)">SpinSpotter</a></li>
				<li class="vis_script"><a href="http://wikileaks.org/" title="WikiLeaks (et nettsted der varslere kan publisere avslørende dokumenter anonymt)">WikiLeaks (et nettsted der varslere kan publisere avslørende dokumenter anonymt)</a></li>
				<li class="vis_script"><a href="https://varsle.aftenposten.no/" title="Aftenposten lanserer ny varslingstjeneste (aftenposten.no 23.3.2012)">Aftenposten lanserer ny varslingstjeneste (aftenposten.no 23.3.2012)</a></li>
				<li class="vis_script"><a href="http://www.google.com/transparencyreport/governmentrequests/">Transparency Report: Government Requests (Google)</a></li>
				<li class="vis_script"><a href="http://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssikkerhetsprisen">Rettssikkerhetsprisen</a></li>
cannot generate system identifier for general entity "search"
Line: 5483, Col: 72
…f="http://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhet…
reference not terminated by REFC delimiter
Line: 5483, Col: 78
…p://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprise…
reference to external entity in attribute value
Line: 5483, Col: 78
…p://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprise…
cannot generate system identifier for general entity "site"
Line: 5483, Col: 84
…w.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" ti…
reference not terminated by REFC delimiter
Line: 5483, Col: 88
…s.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title=…
reference to external entity in attribute value
Line: 5483, Col: 88
…s.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title=…
cannot generate system identifier for general entity "query"
Line: 5483, Col: 92
…/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Ret…
reference not terminated by REFC delimiter
Line: 5483, Col: 97
…not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssik…
reference to external entity in attribute value
Line: 5483, Col: 97
…not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssik…
general entity "search" not defined and no default entity
Line: 5483, Col: 72
…f="http://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhet…
reference to entity "search" for which no system identifier could be generated
Line: 5483, Col: 78
…p://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprise…
general entity "site" not defined and no default entity
Line: 5483, Col: 84
…w.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" ti…
reference to entity "site" for which no system identifier could be generated
Line: 5483, Col: 88
…s.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title=…
general entity "query" not defined and no default entity
Line: 5483, Col: 92
…/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Ret…
reference to entity "query" for which no system identifier could be generated
Line: 5483, Col: 97
…not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssik…
				<li class="vis_script"><a href="http://www.mintankesmie.no/lover_lovdata_og_rettssikkerhet.php" title="Lover (lovdata.no) og rettssikkerhet">Lover (lovdata.no) og rettssikkerhet</a></li>
				<li class="vis_script"><a href="http://www.menneskerettigheter.no/Tema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for loven, rett til hjelp, domstoler, fengsling, arrest, dom m.m.">Rettssikkerhet Likhet for loven, rett til hjelp, domstoler, fengsling, arrest, dom m.m.</a></li>
cannot generate system identifier for general entity "mh"
Line: 5485, Col: 108
…/Tema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for …
reference not terminated by REFC delimiter
Line: 5485, Col: 110
…ema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for lo…
reference to external entity in attribute value
Line: 5485, Col: 110
…ema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for lo…
general entity "mh" not defined and no default entity
Line: 5485, Col: 108
…/Tema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for …
reference to entity "mh" for which no system identifier could be generated
Line: 5485, Col: 110
…ema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for lo…
				<li class="vis_script"><a href="http://www.rettshjelperne.no/" title="Rettshjelp">Rettshjelperne</a></li>
				<li class="vis_script"><a href="http://www.frirettshjelp.no/" title="Fri rettshjelp">Fri rettshjelp</a></li>
				<li class="vis_script"><a href="http://www.meklingsforum.no/" title="Meklingsforum.no">Meklingsforum.no</a></li>
				<li class="vis_script"><a href="http://www.hvitvasking.no/Stottemeny/Kontakt/" title="Kontakt:  Finanstilsynet: 22 93 98 00   EFE/ØKOKRIM: 23 29 14 05">Hvitvasking.no Kontakt:  Finanstilsynet: 22 93 98 00   EFE/ØKOKRIM: 23 29 14 05</a></li>
				<li class="vis_script"><a href="http://www.okokrim.no/artikler/desken-tipstelefon" title="ØKOKRIMs tipstelefon">ØKOKRIMs tipstelefon: 23 29 11 00 - Telefaks 23 29 11 01 - E-post: desken.okokrim@politiet.no</a></li>
				<li class="vis_script"><a href="http://www.okokrim.no/" title="&Oslash;KOKRIM (Den sentrale enhet for etterforskning og påtale av økonomisk kriminalitet og miljøkriminalitet)">&Oslash;KOKRIM (Den sentrale enhet for etterforskning og påtale av økonomisk kriminalitet og miljøkriminalitet)</a></li>
				<li class="vis_script"><a href="http://www.miljokrim.no/" title="&Oslash;kokrim - Tidsskriftet Miljøkrim">&Oslash;kokrim - Tidsskriftet Miljøkrim</a></li>
				<li class="vis_script"><a href="http://www.okokrim.no/artikler/samarbeidspartnere" title="&Oslash;kokrim (Lenker)">&Oslash;kokrim (Lenker)</a></li>
				<li class="vis_script"><a href="http://www.lovdata.no/all/hl-20090306-011.html" title="Lov om tiltak mot hvitvasking og terrorfinansiering mv. (hvitvaskingsloven)">Lov om tiltak mot hvitvasking og terrorfinansiering mv. (hvitvaskingsloven))</a></li>
				<li class="vis_script"><a href="http://www.fatf-gafi.org/" title="The Financial Action Task Force (FATF)">The Financial Action Task Force (FATF)</a></li>
				<li class="vis_script"><a href="http://www.lovdata.no/all/hl-19800613-035.html" title="LOV 1980-06-13 nr 35: Lov om fri rettshjelp">LOV 1980-06-13 nr 35: Lov om fri rettshjelp</a></li>
				<li class="vis_script"><a href="http://www.storby.oslo.kommune.no/fri_rettshjelp/" title="Fri rettshjelp - Oslo kommune">Fri rettshjelp - Oslo kommune</a></li>
				<li class="vis_script"><a href="http://www.lovdata.no/all/hl-20090306-011.html" title="Lov om tiltak mot hvitvasking og terrorfinansiering mv. (hvitvaskingsloven)">Lov om tiltak mot hvitvasking og terrorfinansiering mv. (hvitvaskingsloven)</a></li>
				<li class="vis_script"><a href="http://www.paragrafen.no/?id=11" title="Sivile s&oslash;ksm&aring;l for domstolene">S&oslash;ksm&aring;l</a></li>
				<li class="vis_script"><a href="http://www.lovdata.no/all/hl-20050617-090.html" title="Lov om mekling og rettergang i sivile tvister (tvisteloven)">Lov om mekling og rettergang i sivile tvister (tvisteloven)</a></li>
				<li class="vis_script"><a href="http://www.paragrafen.no/?id=99" title="Saksomkostninger">Saksomkostninger</a></li>
				<li class="vis_script"><a href="http://www.domstol.no/DAtemplates/Article____3068.aspx?epslanguage=NO" title="Rettsgebyr (domstol.no)">Rettsgebyr (domstol.no)</a></li>
				<li class="vis_script"><a href="http://www.lovdata.no/all/hl-19881223-104.html" title="Lov om produktansvar (Produktansvarsloven)">Lov om produktansvar (produkansvarsloven)</a></li>
				<li class="vis_script"><a href="http://www.odin.no/jd/tolkningsuttalelser/erstatning/012041-990022/dok-bn.html" title="Erstatningsrett og forsikringsrett - Produktansvarsloven">Erstatningsrett og forsikringsrett - Produktansvarsloven</a></li>
				<li class="vis_script"><a href="http://www.lovdata.no/all/hl-19020522-010.html" title="Almindelig borgerlig Straffelov (Straffeloven)">Almindelig borgerlig Straffelov (Straffeloven)</a></li>
				<li class="vis_script"><a href="http://www.regelhjelp.no/" title="Regelhjelp arbeidsmilj&oslash;, brann- og eksplosjonsvern, elektriske anlegg og -utstyr, forurensning, industrivern, internkontroll, mattrygghet og produktsikkerhet">Regelhjelp</a></li>
				<li class="vis_script"><a href="http://www.paragrafen.no/nytt.php" title="JussGuiden">JussGuiden</a></li>
				<li class="vis_script"><a href="http://www.rettshjelperne.no/" title="Rettshjelp">Rettshjelperne</a></li>
				<li class="vis_script"><a href="http://www.frirettshjelp.no/" title="Fri rettshjelp">Fri rettshjelp</a></li>
				<li class="vis_script"><a href="http://fylkesmannen.no/fagom.aspx?m=4013" title="(søknadskjema)">(søknadskjema)</a></li>
				<li class="vis_script"><a href="http://www.storby.oslo.kommune.no/fri_rettshjelp/" title="Fri rettshjelp - Oslo kommune">Fri rettshjelp - Oslo kommune</a></li>
				<li class="vis_script"><a href="http://www.domstol.no/DAtemplates/Article____3042.aspx" title="Sidegjøremålregister for dommere - Domstoladministrasjonens register over dommeres sidegjøremål">Sidegjøremålregister for dommere - Domstoladministrasjonens register over dommeres sidegjøremål</a></li>
				<li class="vis_script"><a href="http://www.idunn.no/ts/tfr" title="Tidsskrift for Rettsvitenskap">Tidsskrift for Rettsvitenskap</a></li>
				<li class="vis_script"><a href="http://www.prweb.com/releases/2006/9/prweb432722.htm#" title="LegalView.com Announces New 'DrugWatch' Feature">LegalView.com Announces New 'DrugWatch' Feature</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/Drugs/DrugSafety/PostmarketDrugSafetyInformationforPatientsandProviders/ucm111085.htm" title="FDA: Pakningsvedlegg etc.">FDA: Pakningsvedlegg</a></li>
				<li class="vis_script"><a href="http://www.felleskatalogen.no/preparatidentifisering/" title="Identifikasjon av preparater">Identifikasjon av preparater</a></li>
				<li class="vis_script"><a href="http://www.medicinkombination.dk/" title="Medicinkombination.dk (søk på kombinasjoner)">Medicinkombination.dk (søk på kombinasjoner)</a></li>
				<li class="vis_script"><a href="http://www.fdalegislativewatch.com/" title="FDA Legislative Watch">FDA Legislative Watch</a></li>
				<li class="vis_script"><a href="http://www.fda.gov" title="FDA (Food and Drug Administration)">FDA (Food and Drug Administration)</a></li>
				<li class="vis_script"><a href="http://www.accessdata.fda.gov/psn/viewbroadcasts.cfm" title="FDA (Video Webcast Center)">FDA (Video Webcast Center)</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/psn" title="FDA Patient Safety News">FDA Patient Safety News</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/cder/guidance/index.htm" title="FDA: Guidance Documents">FDA: Guidance Documents</a></li>
				<li class="vis_script"><a href="http://topics.nytimes.com/top/reference/timestopics/organizations/f/food_and_drug_administration/index.html?inline=nyt-org" title="FDA (NYT)">FDA (NYT)</a></li>
				<li class="vis_script"><a href="http://www.accessdata.fda.gov/scripts/cder/drugsatfda/index.cfm?fuseaction=Search.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Names Beginning with "A" (CDER)">FDA Approved Drugs: Drug Names Beginning with "A" (CDER)</a></li>		
cannot generate system identifier for general entity "DrugInitial"
Line: 5524, Col: 140
…useaction=Search.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs…
reference not terminated by REFC delimiter
Line: 5524, Col: 151
…earch.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Name…
reference to external entity in attribute value
Line: 5524, Col: 151
…earch.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Name…
general entity "DrugInitial" not defined and no default entity
Line: 5524, Col: 140
…useaction=Search.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs…
reference to entity "DrugInitial" for which no system identifier could be generated
Line: 5524, Col: 151
…earch.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Name…
an attribute value literal can occur in an attribute specification list only after a VI delimiter
Line: 5524, Col: 210
…ed Drugs: Drug Names Beginning with "A" (CDER)">FDA Approved Drugs: Drug Names…
				<li class="vis_script"><a href="http://www.fdanews.com/" title="FDAnews">FDAnews</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/cder/drug/DrugSafety/DSOBmeetings/default.htm" title="Drug Safety Oversight Board Meetings - Public Summaries">Drug Safety Oversight Board Meetings - Public Summaries</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/cder/guidance/index.htm" title="FDA: Guidance Documents">FDA: Guidance Documents</a></li>
				<li class="vis_script"><a href="http://fdacoalition.org/" title="The Coalition for a Stronger FDA">The Coalition for a Stronger FDA</a></li>
				<li class="vis_script"><a href="http://www.mhra.gov.uk/home/groups/pl-a/documents/publication/con2018041.pdf" title="Les alltid pakningsvedlegget">Les alltid pakningsvedlegget</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/medwatch/safety.htm" title="FDA: MedWatch Safety Information - Drug Labeling Changes 1996-">FDA: MedWatch Safety Information - Drug Labeling Changes 1996-</a></li>
				<li class="vis_script"><a href="http://www.accessdata.fda.gov/scripts/wlcfm/subject.cfm?FL=" title="FDA: Warning Letters">FDA: Warning Letters</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/opacom/7alerts.html" title="Recalls, Market Withdrawals and Safety Alerts">Recalls, Market Withdrawals and Safety Alerts</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/cder/aers/default.htm" title="FDA: Adverse Event Reporting System (AERS)">FDA: Adverse Event Reporting System (AERS)</a></li>				
				<li class="vis_script"><a href="http://www.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folkehelseinstituttet (FHI): Reseptbasert legemiddelregisterReseptbasert legemiddelregister">Folkehelseinstituttet (FHI): Reseptbasert legemiddelregister</a></li>
cannot generate system identifier for general entity "trg"
Line: 5534, Col: 81
…/www.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:1…
reference not terminated by REFC delimiter
Line: 5534, Col: 84
…w.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3…
reference to external entity in attribute value
Line: 5534, Col: 84
…w.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3…
cannot generate system identifier for general entity "MainArea_5661"
Line: 5534, Col: 99
…efault.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0…
reference not terminated by REFC delimiter
Line: 5534, Col: 112
…id=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folk…
reference to external entity in attribute value
Line: 5534, Col: 112
…id=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folk…
general entity "trg" not defined and no default entity
Line: 5534, Col: 81
…/www.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:1…
reference to entity "trg" for which no system identifier could be generated
Line: 5534, Col: 84
…w.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3…
general entity "MainArea_5661" not defined and no default entity
Line: 5534, Col: 99
…efault.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0…
reference to entity "MainArea_5661" for which no system identifier could be generated
Line: 5534, Col: 112
…id=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folk…
				<li class="vis_script"><a href="http://www.legemiddelverket.no/templates/InterPage____25810.aspx" title="SLV: Legemidler under særlig overvåkning">SLV: Legemidler under særlig overvåkning</a></li>
				<li class="vis_script"><a href="http://www.who.int/medicines/areas/quality_safety/safety_efficacy/pharm_restrictions/en/index.html" title="WHO: Pharmaceuticals: restrictions in use and availability">WHO: Pharmaceuticals: restrictions in use and availability</a></li>
				<li class="vis_script"><a href="http://www.legemiddelverket.no/templates/InterPage____14833.aspx" title="SLV (Statens legemiddelverk): Preparatomtaler (SPC)">SLV (Statens legemiddelverk): Preparatomtaler (SPC)</a></li>
				<li class="vis_script"><a href="http://www.felleskatalogen.no/" title="Felleskatalogen - LMI (Legemiddelindustriforeningen)">Felleskatalogen - LMI (Legemiddelindustriforeningen)</a></li>
				<li class="vis_script"><a href="http://en.wikipedia.org/wiki/Physicians%27_Desk_Reference" title="Den amerikanske legemiddelkatalogen PDR (Physicians' Desk Reference)">Den amerikanske legemiddelkatalogen PDR (Physicians' Desk Reference)</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/cder/regulatory/physLabel/default.htm" title="New Requirements for Prescribing Information">FDA: Nye krav til forskrivningsinformasjon</a></li>								
				<li class="vis_script"><a href="http://www.fda.gov/cder/regulatory/investigators/default.htm" title="FDA: Investigational Human Drugs: Clinical Investigator Inspection List (CLIIL)">FDA: Investigational Human Drugs: Clinical Investigator Inspection List (CLIIL)</a></li>					
				<li class="vis_script"><a href="http://www.fda.gov/cder/pmc/default.htm" title="FDA: Postmarketing Study Commitments">FDA: Postmarketing Study Commitments</a></li>
				<li class="vis_script"><a href="http://www.mintankesmie.no/who_om_legemiddelforsok.php" title="WHO (World Health Organization)">WHO (World Health Organization)</a></li>
				<li class="vis_script"><a href="http://www.haiweb.org/" title="Health Action International Foundation (HAI)">Health Action International Foundation (HAI)</a></li>
				<li class="vis_script"><a href="http://www.apotek.no/" title="Apotekforeningen">Apotekforeningen</a></li>
				<li class="vis_script"><a href="http://www.worstpills.org/" title="Public Citizen's Health Research Group: www.worstpills.org">Public Citizen's Health Research Group: www.worstpills.org</a></li>
				<li class="vis_script"><a href="http://www.essentialdrugs.org/edrug/" title="current information on essential drugs">E-drug</a></li>
				<li class="vis_script"><a href="http://www.fda.gov/cder/guidance/7477fnl.pdf" title="Drug Safety Information - FDA's Communication to the Public">Drug Safety Information - FDA's Communication to the Public </a></li>
				<li class="vis_script"><a href="http://www.fda.gov/bbs/topics/answers/2005/ans01368.html" title="FDA Talk Paper">FDA Talk Paper</a></li>
				<li class="vis_script"><a href="http://www.fdaadvisorycommittee.com/FDC/AdvisoryCommittee/TOC.htm" title="FDA Advisory Committee">FDA Advisory Committee</a></li>
				<li class="vis_script"><a href="http://archinte.ama-assn.org/cgi/content/abstract/166/18/1938?etoc" title="The FDA and Drug Safety - A Proposal for Sweeping Changes - Arch Intern Med. 2006;166:1938-1942">The FDA and Drug Safety - A Proposal for Sweeping Changes - Arch Intern Med. 2006;166:1938-1942</a></li>
				<li class="vis_script"><a href="http://www.felleskatalogen.no/" title="Pakningsvedlegg som tekst-til-tale eller blindeskrift - telefon 800 35 550 (ikke komplett!)">Pakningsvedlegg som tekst-til-tale eller blindeskrift - telefon 800 35 550</a></li>
				</ul>
			</div>
		</div>
		
			<script>
required attribute "type" not specified
Line: 5557, Col: 11
<script>
   /* Create a configuration object */
   var ss360Config = {
      /* Your site id */
      siteId: 'www.mintankesmie.no',
      /* A CSS selector that points to your search  box */
      searchBoxSelector: '#searchBox',      
   };
</script>
<script src="https://sitesearch360.com/cdn/sitesearch360-v9.min.js"></script>	
required attribute "type" not specified
Line: 5566, Col: 68
<script src="https://sitesearch360.com/cdn/sitesearch360-v9.min.js"></script>
	
		
		
	</body>
</html>
character "&" is the first character of a delimiter but occurred as data
Line: 2157, Col: 91
…hdata.org/le/" title="Life Expectancy & Probability of Death">healthdata.org</…
character "&" is the first character of a delimiter but occurred as data
Line: 2280, Col: 83
…alicious Software Removal Tool - Safety & Security center (Microsoft)</option>
character "<" is the first character of a delimiter but occurred as data
Line: 2287, Col: 88
…k">TEST: Nødladeren Powerocks Super Magicstick< (dinside.no 3.10.2013)/option>
character "&" is the first character of a delimiter but occurred as data
Line: 2492, Col: 50
…value="resetwinsockinwindows7">Repair & Reset Winsock in Windows 7 (Windows7Th…
character "<" is the first character of a delimiter but occurred as data
Line: 3512, Col: 81
…p" title="Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)">Sukkerin…
reference not terminated by REFC delimiter
Line: 3862, Col: 108
…632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&…
reference to external entity in attribute value
Line: 3862, Col: 108
…632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&…
cannot generate system identifier for general entity "tr_ad_group"
Line: 3862, Col: 130
…gle&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr…
reference not terminated by REFC delimiter
Line: 3862, Col: 141
…paign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&page…
reference to external entity in attribute value
Line: 3862, Col: 141
…paign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&page…
cannot generate system identifier for general entity "tr_brand"
Line: 3862, Col: 148
…orway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=pp…
reference not terminated by REFC delimiter
Line: 3862, Col: 156
…_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1…
reference to external entity in attribute value
Line: 3862, Col: 156
…_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1…
reference not terminated by REFC delimiter
Line: 3862, Col: 163
…tent&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_cam…
cannot generate system identifier for general entity "ssr"
Line: 3862, Col: 167
…&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id…
reference not terminated by REFC delimiter
Line: 3862, Col: 170
…_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=30…
reference to external entity in attribute value
Line: 3862, Col: 170
…_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=30…
cannot generate system identifier for general entity "pagename"
Line: 3862, Col: 177
…up=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381…
reference not terminated by REFC delimiter
Line: 3862, Col: 185
…&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_i…
reference to external entity in attribute value
Line: 3862, Col: 185
…&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_i…
cannot generate system identifier for general entity "ft"
Line: 3862, Col: 192
…nd=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486…
reference not terminated by REFC delimiter
Line: 3862, Col: 194
…=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637…
reference to external entity in attribute value
Line: 3862, Col: 194
…=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637…
cannot generate system identifier for general entity "tr_camp_id"
Line: 3862, Col: 197
…lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637306…
reference not terminated by REFC delimiter
Line: 3862, Col: 207
…r=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_netwo…
reference to external entity in attribute value
Line: 3862, Col: 207
…r=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_netwo…
cannot generate system identifier for general entity "tr_ag_id"
Line: 3862, Col: 218
…ename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_key…
reference not terminated by REFC delimiter
Line: 3862, Col: 226
…cgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gra…
reference to external entity in attribute value
Line: 3862, Col: 226
…cgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gra…
cannot generate system identifier for general entity "tr_network"
Line: 3862, Col: 239
…amp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_pla…
reference not terminated by REFC delimiter
Line: 3862, Col: 249
…223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www…
reference to external entity in attribute value
Line: 3862, Col: 249
…223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www…
cannot generate system identifier for general entity "tr_keyword"
Line: 3862, Col: 252
…381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.di…
reference not terminated by REFC delimiter
Line: 3862, Col: 262
…id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_m…
reference to external entity in attribute value
Line: 3862, Col: 262
…id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_m…
cannot generate system identifier for general entity "tr_placement"
Line: 3862, Col: 273
…061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&t…
reference not terminated by REFC delimiter
Line: 3862, Col: 285
…rk=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=n…
reference to external entity in attribute value
Line: 3862, Col: 285
…rk=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=n…
cannot generate system identifier for general entity "tr_matchtype"
Line: 3862, Col: 298
…rd=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creati…
reference not terminated by REFC delimiter
Line: 3862, Col: 310
…&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=770836974…
reference to external entity in attribute value
Line: 3862, Col: 310
…&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=770836974…
cannot generate system identifier for general entity "tr_position"
Line: 3862, Col: 312
…r_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421…
reference not terminated by REFC delimiter
Line: 3862, Col: 323
…=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=…
reference to external entity in attribute value
Line: 3862, Col: 323
…=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=…
cannot generate system identifier for general entity "tr_creative"
Line: 3862, Col: 329
…igi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_d…
reference not terminated by REFC delimiter
Line: 3862, Col: 340
…atchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model…
reference to external entity in attribute value
Line: 3862, Col: 340
…atchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model…
cannot generate system identifier for general entity "tr_device"
Line: 3862, Col: 353
…position=none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extensio…
reference not terminated by REFC delimiter
Line: 3862, Col: 362
…none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_…
reference to external entity in attribute value
Line: 3862, Col: 362
…none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_…
cannot generate system identifier for general entity "tr_device_model"
Line: 3862, Col: 365
…e&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_tar…
reference not terminated by REFC delimiter
Line: 3862, Col: 380
…7083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-9698…
reference to external entity in attribute value
Line: 3862, Col: 380
…7083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-9698…
cannot generate system identifier for general entity "tr_extension_id"
Line: 3862, Col: 382
…83697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859…
reference not terminated by REFC delimiter
Line: 3862, Col: 397
…ice=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location…
reference to external entity in attribute value
Line: 3862, Col: 397
…ice=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location…
cannot generate system identifier for general entity "tr_target_id"
Line: 3862, Col: 399
…e=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9…
reference not terminated by REFC delimiter
Line: 3862, Col: 411
…e_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_pl…
reference to external entity in attribute value
Line: 3862, Col: 411
…e_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_pl…
cannot generate system identifier for general entity "tr_location"
Line: 3862, Col: 426
…ension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=…
reference not terminated by REFC delimiter
Line: 3862, Col: 437
…tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyO…
reference to external entity in attribute value
Line: 3862, Col: 437
…tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyO…
cannot generate system identifier for general entity "tr_placement_target"
Line: 3862, Col: 446
…_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCF…
reference not terminated by REFC delimiter
Line: 3862, Col: 465
…r_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" titl…
reference to external entity in attribute value
Line: 3862, Col: 465
…r_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" titl…
cannot generate system identifier for general entity "gclid"
Line: 3862, Col: 467
…location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title=…
reference not terminated by REFC delimiter
Line: 3862, Col: 472
…ion=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="Fami…
reference to external entity in attribute value
Line: 3862, Col: 472
…ion=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="Fami…
cannot generate system identifier for general entity "utm_source"
Line: 3862, Col: 74
…k.com/no/ppc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norwa…
reference not terminated by REFC delimiter
Line: 3862, Col: 84
…pc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Co…
reference to external entity in attribute value
Line: 3862, Col: 84
…pc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Co…
cannot generate system identifier for general entity "utm_campaign"
Line: 3862, Col: 96
…nt=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_…
cannot generate system identifier for general entity "cat"
Line: 4579, Col: 73
…egnar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakern…
reference not terminated by REFC delimiter
Line: 4579, Col: 76
…ar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne m…
reference to external entity in attribute value
Line: 4579, Col: 76
…ar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne m…
reference not terminated by REFC delimiter
Line: 4889, Col: 104
…r_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal…
reference to external entity in attribute value
Line: 4889, Col: 104
…r_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal…
cannot generate system identifier for general entity "p_otr_anntid"
Line: 4889, Col: 114
…OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_kn…
reference not terminated by REFC delimiter
Line: 4889, Col: 126
…&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p…
reference to external entity in attribute value
Line: 4889, Col: 126
…&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p…
cannot generate system identifier for general entity "p_otr_kanal"
Line: 4889, Col: 133
…sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikk…
reference not terminated by REFC delimiter
Line: 4889, Col: 144
…0080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Pa…
reference to external entity in attribute value
Line: 4889, Col: 144
…0080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Pa…
cannot generate system identifier for general entity "p_knapp"
Line: 4889, Col: 150
…0&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om …
reference not terminated by REFC delimiter
Line: 4889, Col: 157
…_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</…
reference to external entity in attribute value
Line: 4889, Col: 157
…_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</…
cannot generate system identifier for general entity "p_artikkel_id"
Line: 4889, Col: 165
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
reference not terminated by REFC delimiter
Line: 4889, Col: 178
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
reference to external entity in attribute value
Line: 4889, Col: 178
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
cannot generate system identifier for general entity "p_otr_sendedato"
Line: 4889, Col: 89
…moversikt/?p_otr_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19…
cannot generate system identifier for general entity "utm_medium"
Line: 4992, Col: 101
…fallet-utreds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_conte…
reference not terminated by REFC delimiter
Line: 4992, Col: 111
…eds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspeci…
reference to external entity in attribute value
Line: 4992, Col: 111
…eds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspeci…
cannot generate system identifier for general entity "utm_content"
Line: 4992, Col: 132
…-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=uns…
reference not terminated by REFC delimiter
Line: 4992, Col: 143
…medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Q…
reference to external entity in attribute value
Line: 4992, Col: 143
…medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Q…
reference not terminated by REFC delimiter
Line: 4992, Col: 168
…M&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br…
reference to external entity in attribute value
Line: 4992, Col: 168
…M&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br…
cannot generate system identifier for general entity "id"
Line: 5166, Col: 111
…ttp://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale…
reference not terminated by REFC delimiter
Line: 5166, Col: 113
…p://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f…
reference to external entity in attribute value
Line: 5166, Col: 113
…p://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f…
cannot generate system identifier for general entity "cid"
Line: 5293, Col: 158
…nerellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!<…
reference not terminated by REFC delimiter
Line: 5293, Col: 161
…ellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a>…
reference to external entity in attribute value
Line: 5293, Col: 161
…ellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a>…
reference not terminated by REFC delimiter
Line: 5293, Col: 96
…/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/V…
reference to external entity in attribute value
Line: 5293, Col: 96
…/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/V…
cannot generate system identifier for general entity "search"
Line: 5483, Col: 72
…f="http://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhet…
reference not terminated by REFC delimiter
Line: 5483, Col: 78
…p://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprise…
reference to external entity in attribute value
Line: 5483, Col: 78
…p://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprise…
cannot generate system identifier for general entity "site"
Line: 5483, Col: 84
…w.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" ti…
reference not terminated by REFC delimiter
Line: 5483, Col: 88
…s.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title=…
reference to external entity in attribute value
Line: 5483, Col: 88
…s.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title=…
cannot generate system identifier for general entity "query"
Line: 5483, Col: 92
…/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Ret…
reference not terminated by REFC delimiter
Line: 5483, Col: 97
…not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssik…
reference to external entity in attribute value
Line: 5483, Col: 97
…not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssik…
cannot generate system identifier for general entity "mh"
Line: 5485, Col: 108
…/Tema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for …
reference not terminated by REFC delimiter
Line: 5485, Col: 110
…ema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for lo…
reference to external entity in attribute value
Line: 5485, Col: 110
…ema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for lo…
cannot generate system identifier for general entity "DrugInitial"
Line: 5524, Col: 140
…useaction=Search.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs…
reference not terminated by REFC delimiter
Line: 5524, Col: 151
…earch.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Name…
reference to external entity in attribute value
Line: 5524, Col: 151
…earch.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Name…
reference not terminated by REFC delimiter
Line: 5534, Col: 112
…id=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folk…
reference to external entity in attribute value
Line: 5534, Col: 112
…id=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folk…
cannot generate system identifier for general entity "trg"
Line: 5534, Col: 81
…/www.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:1…
reference not terminated by REFC delimiter
Line: 5534, Col: 84
…w.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3…
reference to external entity in attribute value
Line: 5534, Col: 84
…w.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3…
cannot generate system identifier for general entity "MainArea_5661"
Line: 5534, Col: 99
…efault.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0…
duplicate specification of attribute "class"
Line: 111, Col: 55
…e="storenorske" class="addgray" class="addgray">STORE NORSKE LEKSIKON - STORE …
document type does not allow element "option" here
Line: 2288, Col: 54
…e="internetexplorer11" class="addgray">Internet Explorer, Office etc. (Microso…
document type does not allow element "option" here
Line: 2289, Col: 36
<option value="cookiesnettsider">Hvilke krav stilles for å bruke cookies på …
document type does not allow element "option" here
Line: 2290, Col: 36
<option value="rengjorpctelenor">Rengjør PC-en – få bedre ytelse (telenor.no…
document type does not allow element "option" here
Line: 2291, Col: 34
<option value="koblepctilnett">Vil du koble PCen til TVen? (netonnet.no</opt…
document type does not allow element "option" here
Line: 2292, Col: 54
…e="norsisgratisonline" class="addgray">Fjerning av skadelig kode - Hvordan opp…
document type does not allow element "option" here
Line: 2293, Col: 42
<option value="windowsdefenderoffline">Windows Defender Offline</option>
document type does not allow element "option" here
Line: 2294, Col: 63
…upportcentermicrosoft" class="addgray">Fixit support center (Finn automatisert…
document type does not allow element "option" here
Line: 2295, Col: 47
…on value="microsoftsecurityessentials">Micrsoft Kundestøtte - Løs et teknisk p…
document type does not allow element "option" here
Line: 2296, Col: 55
…="adobeflahnedlasting" class="addgray">Adobe - Lesere og spillere - Produktned…
document type does not allow element "option" here
Line: 2297, Col: 36
<option value="freejavadownload">Free Java Download</option>
document type does not allow element "option" here
Line: 2298, Col: 30
<option value="verifyjava">Verify Java and Find Out-of-Date Versions</option…
document type does not allow element "option" here
Line: 2299, Col: 48
…n value="browsercheck" class="addgray">Browser Check (Start a browser check to…
document type does not allow element "option" here
Line: 2300, Col: 37
<option value="dnschangercheckup">DNS Changer Check-Up</option>
document type does not allow element "option" here
Line: 2301, Col: 45
…tion value="filezilla" class="addgray">FileZilla, the free FTP solution</optio…
document type does not allow element "option" here
Line: 2302, Col: 34
<option value="systemmechanic">Gjør datamaskinen raskere med System Mechanic…
document type does not allow element "option" here
Line: 2303, Col: 50
…value="toolbarcleaner" class="addgray">Toolbar Cleaner (fjern uønskede verktøy…
document type does not allow element "option" here
Line: 2304, Col: 35
<option value="multirframeasus">MultiFrame (ASUS)</option>
document type does not allow element "option" here
Line: 2305, Col: 31
<option value="pdfpreview7">PDF Preview for Windows 7</option>
document type does not allow element "option" here
Line: 2306, Col: 31
<option value="techtracker">TechTracker (CNET)</option>
document type does not allow element "option" here
Line: 2307, Col: 38
<option value="crashanalysistools">Crash Analysis Tools - WhoCrashed 2.00 ("…
document type does not allow element "option" here
Line: 2308, Col: 36
<option value="freepdfconverter">doPDF free PDF converter (lagre nettsider -…
document type does not allow element "option" here
Line: 2309, Col: 30
<option value="anybizsoft">AnyBizSoft PDF to Word Converter (PDF to Word etc…
document type does not allow element "option" here
Line: 2310, Col: 31
<option value="foxitreader">Foxit Reader (foxitsoftware.com)</option>
document type does not allow element "option" here
Line: 2311, Col: 30
<option value="enpdfleser">Få en PDF-leser som er fri programvare! (pdfreade…
document type does not allow element "option" here
Line: 2312, Col: 36
<option value="freejavadownload">Free Java Download - Download Java for your…
document type does not allow element "option" here
Line: 2313, Col: 28
<option value="unlocker">Unlocker - unable to delete a file in Windows, Unlo…
document type does not allow element "option" here
Line: 2314, Col: 30
<option value="freeopener">FREEOPENER - Open Many File Types for FREE!</opti…
document type does not allow element "option" here
Line: 2315, Col: 36
<option value="driveridentifier">DRIVER INDENTIFIER DOWNLOAD (Find and Updat…
document type does not allow element "option" here
Line: 2316, Col: 37
<option value="keyboardcleantool">KeyboardCleanTool (It just blocks your key…
document type does not allow element "option" here
Line: 2317, Col: 30
<option value="digitvie68">digi TV: Microsoft om IE6 og IE8 del 1 av 5 (yout…
document type does not allow element "option" here
Line: 2318, Col: 29
<option value="skalfikse">Skal fikse store nettsteder med dårlig kode (9.12.…
document type does not allow element "option" here
Line: 2319, Col: 25
<option value="opera">Opera (Opera Software ASA)</option>
document type does not allow element "option" here
Line: 2320, Col: 27
<option value="firefox">Firefox (Mozilla Europe og Mozilla Foundation)</opti…
document type does not allow element "option" here
Line: 2321, Col: 26
<option value="safari">Safari (Apple Inc.)</option>
document type does not allow element "option" here
Line: 2322, Col: 25
<option value="flock">Flock (Flock, Inc.)</option>
document type does not allow element "option" here
Line: 2323, Col: 41
… <option value="mostpopularinbrowsers">Most Popular in Browsers (CNET Download…
document type does not allow element "option" here
Line: 2324, Col: 37
<option value="browserstatistics">Browser Statistics (w3schools.com)</option…
document type does not allow element "option" here
Line: 2325, Col: 49
… value="bakgrunnsbilderintterfacelift">Bakgrunnsbilder (InterfaceLIFT - Free H…
document type does not allow element "option" here
Line: 2326, Col: 32
<option value="desktopearth">Desktop Earth (codefromthe70s.org)</option>
document type does not allow element "option" here
Line: 2327, Col: 46
…ion value="nettleserefunksjonshemmede">Nettlesere spesielt laget for funksjons…
document type does not allow element "option" here
Line: 2328, Col: 37
<option value="rolltalkfalckigel">Rolltalk (FALCK IGEL) (Rolltalk brukes av …
document type does not allow element "option" here
Line: 2329, Col: 27
<option value="medialt">MediaLT (MediaLT er et annerledes IT firma, som sats…
document type does not allow element "option" here
Line: 2330, Col: 29
<option value="lingspeak">LingSpeak (Er du lesesvak? LingSpeak leser teksten…
document type does not allow element "option" here
Line: 2331, Col: 26
<option value="cogain">COGAIN: Communication by Gaze Interaction (interface …
end tag for "option" omitted, but OMITTAG NO was specified
Line: 2332, Col: 14
</optgroup>
end tag for element "a" which is not open
Line: 2736, Col: 68
…industrien">Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)</option>
document type does not allow element "strong" here
Line: 2952, Col: 61
…lue="somadril">Somadril (karisoprodol) (<strong>CARISOPRODOL</strong>)</option>
end tag for element "a" which is not open
Line: 3512, Col: 174
…ngsmidler)">Sukkerindustrien (Big Sugar)</a> (Kunstige søtningsmidler)</a></li>
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3526, Col: 4
<li><a href="apoteker.php" title="Apoteker (apotekforeninger)">Apoteker (apotek…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3527, Col: 4
<li><a href="legemiddelnavn_som_arsak_til_feilmedisinering.php" title="Legemidd…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3528, Col: 4
<li><a href="bivirkninger_symptomer_og_sykdommer.php" title="Bivirkninger sympt…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3529, Col: 4
<li><a href="bivirkninger_organskader.php" title="Bivirkninger (legemiddelindus…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3530, Col: 4
<li><a href="fosterskader_legemiddelrelaterte.php" title="Fosterskader (legemid…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3531, Col: 4
<li><a href="legemiddelindusert_kreft_og_andre_typer_celleskader.php" title="Le…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3532, Col: 4
<li><a href="ct_mr_ultrasonografi_rontgen_kontrastmidler.php" title="Computerto…
document type does not allow element "li" here; missing one of "ul", "ol" start-tag
Line: 3533, Col: 4
<li><a href="medisinsk_utstyr.php" title="Medisinsk utstyr">Medisinsk utstyr</a…
end tag for "li" omitted, but OMITTAG NO was specified
Line: 3534, Col: 5
</ul>
reference to entity "utm_campaign" for which no system identifier could be generated
Line: 3862, Col: 108
…632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&…
general entity "tr_ad_group" not defined and no default entity
Line: 3862, Col: 130
…gle&utm_campaign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr…
reference to entity "tr_ad_group" for which no system identifier could be generated
Line: 3862, Col: 141
…paign=Norway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&page…
general entity "tr_brand" not defined and no default entity
Line: 3862, Col: 148
…orway_NO_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=pp…
reference to entity "tr_brand" for which no system identifier could be generated
Line: 3862, Col: 156
…_FL_Content&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1…
general entity "ssr" not defined and no default entity
Line: 3862, Col: 167
…&tr_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id…
reference to entity "ssr" for which no system identifier could be generated
Line: 3862, Col: 170
…_ad_group=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=30…
general entity "pagename" not defined and no default entity
Line: 3862, Col: 177
…up=Death&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381…
reference to entity "pagename" for which no system identifier could be generated
Line: 3862, Col: 185
…&tr_brand=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_i…
general entity "ft" not defined and no default entity
Line: 3862, Col: 192
…nd=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486…
reference to entity "ft" for which no system identifier could be generated
Line: 3862, Col: 194
…=2&lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637…
general entity "tr_camp_id" not defined and no default entity
Line: 3862, Col: 197
…lang=NO&ssr=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=1948637306…
reference to entity "tr_camp_id" for which no system identifier could be generated
Line: 3862, Col: 207
…r=death&pagename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_netwo…
general entity "tr_ag_id" not defined and no default entity
Line: 3862, Col: 218
…ename=ppcgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_key…
reference to entity "tr_ag_id" for which no system identifier could be generated
Line: 3862, Col: 226
…cgd&ft=1&tr_camp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gra…
general entity "tr_network" not defined and no default entity
Line: 3862, Col: 239
…amp_id=302223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_pla…
reference to entity "tr_network" for which no system identifier could be generated
Line: 3862, Col: 249
…223381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www…
general entity "tr_keyword" not defined and no default entity
Line: 3862, Col: 252
…381&tr_ag_id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.di…
reference to entity "tr_keyword" for which no system identifier could be generated
Line: 3862, Col: 262
…id=19486373061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_m…
general entity "tr_placement" not defined and no default entity
Line: 3862, Col: 273
…061&tr_network=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&t…
reference to entity "tr_placement" for which no system identifier could be generated
Line: 3862, Col: 285
…rk=d&tr_keyword=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=n…
general entity "tr_matchtype" not defined and no default entity
Line: 3862, Col: 298
…rd=gravplass&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creati…
reference to entity "tr_matchtype" for which no system identifier could be generated
Line: 3862, Col: 310
…&tr_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=770836974…
general entity "tr_position" not defined and no default entity
Line: 3862, Col: 312
…r_placement=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421…
reference to entity "tr_position" for which no system identifier could be generated
Line: 3862, Col: 323
…=www.digi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=…
general entity "tr_creative" not defined and no default entity
Line: 3862, Col: 329
…igi.no&tr_matchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_d…
reference to entity "tr_creative" for which no system identifier could be generated
Line: 3862, Col: 340
…atchtype=&tr_position=none&tr_creative=77083697421&tr_device=c&tr_device_model…
general entity "tr_device" not defined and no default entity
Line: 3862, Col: 353
…position=none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extensio…
reference to entity "tr_device" for which no system identifier could be generated
Line: 3862, Col: 362
…none&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_…
general entity "tr_device_model" not defined and no default entity
Line: 3862, Col: 365
…e&tr_creative=77083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_tar…
reference to entity "tr_device_model" for which no system identifier could be generated
Line: 3862, Col: 380
…7083697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-9698…
general entity "tr_extension_id" not defined and no default entity
Line: 3862, Col: 382
…83697421&tr_device=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859…
reference to entity "tr_extension_id" for which no system identifier could be generated
Line: 3862, Col: 397
…ice=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location…
general entity "tr_target_id" not defined and no default entity
Line: 3862, Col: 399
…e=c&tr_device_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9…
reference to entity "tr_target_id" for which no system identifier could be generated
Line: 3862, Col: 411
…e_model=&tr_extension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_pl…
general entity "tr_location" not defined and no default entity
Line: 3862, Col: 426
…ension_id=&tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=…
reference to entity "tr_location" for which no system identifier could be generated
Line: 3862, Col: 437
…tr_target_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyO…
general entity "tr_placement_target" not defined and no default entity
Line: 3862, Col: 446
…_id=kwd-969859107&tr_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCF…
reference to entity "tr_placement_target" for which no system identifier could be generated
Line: 3862, Col: 465
…r_location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" titl…
general entity "gclid" not defined and no default entity
Line: 3862, Col: 467
…location=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title=…
reference to entity "gclid" for which no system identifier could be generated
Line: 3862, Col: 472
…ion=9047247&tr_placement_target=&gclid=CJyOq9yJi8gCFcnUcgodnkYEFw" title="Fami…
general entity "utm_source" not defined and no default entity
Line: 3862, Col: 74
…k.com/no/ppc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norwa…
reference to entity "utm_source" for which no system identifier could be generated
Line: 3862, Col: 84
…pc/?tr_account=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Co…
general entity "utm_campaign" not defined and no default entity
Line: 3862, Col: 96
…nt=863-433-1632&utm_source=ppc_google&utm_campaign=Norway_NO_FL_Content&tr_ad_…
an attribute value literal can occur in an attribute specification list only after a VI delimiter
Line: 4050, Col: 109
…" title="merriamcomdictionary" WEBSTER'S Medical Dictionary (Medisinsk ordbok …
there is no attribute "target"
Line: 4354, Col: 487
…pen.no/nb_NO/ossietzkyprisen/" target="_blank">Ossietzky-prisen</a>. (<a href…
general entity "cat" not defined and no default entity
Line: 4579, Col: 73
…egnar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakern…
reference to entity "cat" for which no system identifier could be generated
Line: 4579, Col: 76
…ar.no/hegnar/newsdet.asp?id=260427&cat=103">&ndash; Sosialhjelps- mottakerne m…
reference to entity "p_otr_sendedato" for which no system identifier could be generated
Line: 4889, Col: 104
…r_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal…
general entity "p_otr_anntid" not defined and no default entity
Line: 4889, Col: 114
…OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_kn…
reference to entity "p_otr_anntid" for which no system identifier could be generated
Line: 4889, Col: 126
…&p_otr_sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p…
general entity "p_otr_kanal" not defined and no default entity
Line: 4889, Col: 133
…sendedato=20080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikk…
reference to entity "p_otr_kanal" for which no system identifier could be generated
Line: 4889, Col: 144
…0080930&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Pa…
general entity "p_knapp" not defined and no default entity
Line: 4889, Col: 150
…0&p_otr_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om …
reference to entity "p_knapp" for which no system identifier could be generated
Line: 4889, Col: 157
…_anntid=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</…
general entity "p_artikkel_id" not defined and no default entity
Line: 4889, Col: 165
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
reference to entity "p_artikkel_id" for which no system identifier could be generated
Line: 4889, Col: 178
…=19.55&p_otr_kanal=NRK1&p_knapp=Omtale&p_artikkel_id=0">Paus om Norge</a><br />
general entity "p_otr_sendedato" not defined and no default entity
Line: 4889, Col: 89
…moversikt/?p_otr_prog_id=OKFV14000507&p_otr_sendedato=20080930&p_otr_anntid=19…
general entity "utm_medium" not defined and no default entity
Line: 4992, Col: 101
…fallet-utreds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_conte…
reference to entity "utm_medium" for which no system identifier could be generated
Line: 4992, Col: 111
…eds/?utm_source=apsis-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspeci…
general entity "utm_content" not defined and no default entity
Line: 4992, Col: 132
…-anp-3&utm_medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=uns…
reference to entity "utm_content" for which no system identifier could be generated
Line: 4992, Col: 143
…medium=nyhetsbrev%20-%20DM&utm_content=unspecified&utm_campaign=unspecified">Q…
reference to entity "utm_campaign" for which no system identifier could be generated
Line: 4992, Col: 168
…M&utm_content=unspecified&utm_campaign=unspecified">Quick-fallet utreds</a><br…
value of attribute "dir" cannot be "auto"; must be one of "ltr", "rtl"
Line: 5111, Col: 51
…<strong>Anm</strong>: <span dir="auto"><em>Funksjonell magnetresonanstomograf…
general entity "id" not defined and no default entity
Line: 5166, Col: 111
…ttp://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale…
reference to entity "id" for which no system identifier could be generated
Line: 5166, Col: 113
…p://nyheter.uib.no/?modus=vis_nyhet&id=43478">Falske forteljingar med fatale f…
general entity "cid" not defined and no default entity
Line: 5293, Col: 158
…nerellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!<…
reference to entity "cid" for which no system identifier could be generated
Line: 5293, Col: 161
…ellArtikkel/VisMedHovedtilhorighet&cid=1177351330915">Det er jus over alt!</a>…
reference to entity "pagename" for which no system identifier could be generated
Line: 5293, Col: 96
…/Satellite?c=GenerellArtikkel&pagename=ForskningsradetNorsk/GenerellArtikkel/V…
general entity "search" not defined and no default entity
Line: 5483, Col: 72
…f="http://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhet…
reference to entity "search" for which no system identifier could be generated
Line: 5483, Col: 78
…p://www.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprise…
general entity "site" not defined and no default entity
Line: 5483, Col: 84
…w.jus.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" ti…
reference to entity "site" for which no system identifier could be generated
Line: 5483, Col: 88
…s.no/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title=…
general entity "query" not defined and no default entity
Line: 5483, Col: 92
…/?do_not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Ret…
reference to entity "query" for which no system identifier could be generated
Line: 5483, Col: 97
…not_expire=1&search=site&site=on&query=Rettssikkerhetsprisen+" title="Rettssik…
general entity "mh" not defined and no default entity
Line: 5485, Col: 108
…/Tema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for …
reference to entity "mh" for which no system identifier could be generated
Line: 5485, Col: 110
…ema/Rettssikkerhet/index.html?nh=10&mh=10" title="Rettssikkerhet Likhet for lo…
general entity "DrugInitial" not defined and no default entity
Line: 5524, Col: 140
…useaction=Search.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs…
reference to entity "DrugInitial" for which no system identifier could be generated
Line: 5524, Col: 151
…earch.SearchResults_Browse&DrugInitial=A" title="FDA Approved Drugs: Drug Name…
an attribute value literal can occur in an attribute specification list only after a VI delimiter
Line: 5524, Col: 210
…ed Drugs: Drug Names Beginning with "A" (CDER)">FDA Approved Drugs: Drug Names…
reference to entity "MainArea_5661" for which no system identifier could be generated
Line: 5534, Col: 112
…id=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0" title="Folk…
general entity "trg" not defined and no default entity
Line: 5534, Col: 81
…/www.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:1…
reference to entity "trg" for which no system identifier could be generated
Line: 5534, Col: 84
…w.fhi.no/eway/default.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3…
general entity "MainArea_5661" not defined and no default entity
Line: 5534, Col: 99
…efault.aspx?pid=233&trg=MainArea_5661&MainArea_5661=5631:0:15,3791:1:0:0:::0:0…
required attribute "type" not specified
Line: 5557, Col: 11
<script>
required attribute "type" not specified
Line: 5566, Col: 68
<script src="https://sitesearch360.com/cdn/sitesearch360-v9.min.js"></script>